SitesBLAST
Comparing HSERO_RS12985 FitnessBrowser__HerbieS:HSERO_RS12985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
38% identity, 97% coverage: 4:373/380 of query aligns to 3:349/369 of P05414
- Y24 (= Y25) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PTG 78:80) binding
- S106 (= S107) binding
- W108 (≠ M109) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (= QLY 128:130) binding
- T155 (= T156) binding
- K230 (= K254) binding
- S252 (= S276) binding
- DGGVR 285:289 (≠ DGGIR 309:313) binding
- GR 308:309 (= GR 332:333) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
38% identity, 97% coverage: 4:373/380 of query aligns to 2:343/353 of 5zbmB
- active site: Y128 (= Y130), D156 (= D158), H248 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ A26), P76 (= P78), T77 (= T79), W107 (≠ M109), Q126 (= Q128), Y128 (= Y130), T154 (= T156), K224 (= K254), H248 (= H278), G249 (= G279), R251 (= R281), D279 (= D309), G280 (= G310), R283 (= R313), G302 (= G332), R303 (= R333)
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
38% identity, 97% coverage: 4:373/380 of query aligns to 3:340/350 of 1al7A
- active site: S106 (= S107), Y129 (= Y130), T155 (= T156), D157 (= D158), K221 (= K254), H245 (= H278)
- binding flavin mononucleotide: Y24 (= Y25), Y25 (≠ A26), P77 (= P78), T78 (= T79), A79 (≠ G80), S106 (= S107), Q127 (= Q128), T155 (= T156), K221 (= K254), H245 (= H278), R248 (= R281), D276 (= D309), G277 (= G310), R280 (= R313), G299 (= G332), R300 (= R333)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y25), W108 (≠ M109), Y129 (= Y130), R164 (= R165), F172 (≠ M173), I198 (≠ F231), H245 (= H278), R248 (= R281)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
34% identity, 98% coverage: 1:371/380 of query aligns to 2:351/360 of 6gmcA
- active site: Y132 (= Y130), D160 (= D158), H258 (= H278)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y25), M82 (≠ L81), W110 (≠ M109), Y132 (= Y130), R167 (= R165), F191 (≠ S189), L203 (= L223), Y206 (≠ W226), H258 (= H278), R261 (= R281)
- binding flavin mononucleotide: Y26 (= Y25), Y27 (≠ A26), A79 (≠ P78), T80 (= T79), A81 (≠ G80), S108 (= S107), Q130 (= Q128), Y132 (= Y130), T158 (= T156), K234 (= K254), H258 (= H278), G259 (= G279), R261 (= R281), D289 (= D309), G290 (= G310), R293 (= R313), G312 (= G332), R313 (= R333)
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
36% identity, 98% coverage: 7:378/380 of query aligns to 6:370/373 of 6bfgA
- active site: Y129 (= Y130), D156 (= D158), H272 (= H278)
- binding flavin mononucleotide: Y24 (= Y25), P77 (= P78), T78 (= T79), G79 (= G80), Q127 (= Q128), Y129 (= Y130), T154 (= T156), K248 (= K254), H272 (= H278), G273 (= G279), R275 (= R281), D301 (= D309), S302 (≠ G310), G303 (= G311), R305 (= R313), G324 (= G332), R325 (= R333)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
36% identity, 98% coverage: 7:378/380 of query aligns to 8:372/393 of P20932
- PTG 79:81 (= PTG 78:80) binding
- G81 (= G80) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S107) binding
- Q129 (= Q128) binding
- T156 (= T156) binding
- K250 (= K254) binding
- DSGFR 303:307 (≠ DGGIR 309:313) binding
- GR 326:327 (= GR 332:333) binding
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
40% identity, 97% coverage: 9:378/380 of query aligns to 12:363/365 of Q8Z0C8
- M82 (≠ T79) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ M109) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ T227) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
34% identity, 98% coverage: 1:371/380 of query aligns to 2:353/370 of Q9UJM8
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
34% identity, 98% coverage: 1:371/380 of query aligns to 2:353/362 of 6gmbA
- active site: Y132 (= Y130), D160 (= D158), H260 (= H278)
- binding flavin mononucleotide: Y26 (= Y25), Y27 (≠ A26), A79 (≠ P78), T80 (= T79), A81 (≠ G80), S108 (= S107), Q130 (= Q128), Y132 (= Y130), K236 (= K254), H260 (= H278), G261 (= G279), R263 (= R281), D291 (= D309), G292 (= G310), G293 (= G311), R295 (= R313), G314 (= G332), R315 (= R333)
- binding glycolic acid: Y26 (= Y25), W110 (≠ M109), Y132 (= Y130), R167 (= R165), H260 (= H278), R263 (= R281)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
34% identity, 97% coverage: 2:371/380 of query aligns to 1:351/360 of 2rduA
- active site: S106 (= S107), Y130 (= Y130), T156 (= T156), D158 (= D158), K234 (= K254), H258 (= H278)
- binding flavin mononucleotide: Y24 (= Y25), Y25 (≠ A26), A77 (≠ P78), T78 (= T79), A79 (≠ G80), S106 (= S107), Q128 (= Q128), Y130 (= Y130), T156 (= T156), K234 (= K254), H258 (= H278), G259 (= G279), R261 (= R281), D289 (= D309), G290 (= G310), G291 (= G311), R293 (= R313), G312 (= G332), R313 (= R333)
- binding glyoxylic acid: Y24 (= Y25), W108 (≠ M109), Y130 (= Y130), R165 (= R165), H258 (= H278), R261 (= R281)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
36% identity, 98% coverage: 7:378/380 of query aligns to 5:350/353 of 2a85A
- active site: S105 (= S107), Y128 (= Y130), T153 (= T156), D155 (= D158), K228 (= K254), H252 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), P76 (= P78), T77 (= T79), A78 (≠ G80), S105 (= S107), Q126 (= Q128), Y128 (= Y130), T153 (= T156), K228 (= K254), H252 (= H278), G253 (= G279), R255 (= R281), D281 (= D309), S282 (≠ G310), G283 (= G311), R285 (= R313), G304 (= G332), R305 (= R333)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y130), N159 (≠ L162), G160 (= G163), R162 (= R165), H252 (= H278), R255 (= R281)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
36% identity, 98% coverage: 7:378/380 of query aligns to 5:350/353 of 2a7pA
- active site: S105 (= S107), Y128 (= Y130), T153 (= T156), D155 (= D158), K228 (= K254), H252 (= H278)
- binding 3-(indol-3-yl) lactate: Y128 (= Y130), R162 (= R165), H252 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), P76 (= P78), T77 (= T79), A78 (≠ G80), S105 (= S107), Q126 (= Q128), Y128 (= Y130), T153 (= T156), K228 (= K254), H252 (= H278), G253 (= G279), R255 (= R281), D281 (= D309), S282 (≠ G310), G283 (= G311), R285 (= R313), G304 (= G332), R305 (= R333)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
34% identity, 98% coverage: 1:371/380 of query aligns to 1:343/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y25), A80 (≠ G80), M81 (≠ L81), W109 (≠ M109), Y131 (= Y130), R166 (= R165), M182 (≠ L181), H250 (= H278), R253 (= R281)
- binding flavin mononucleotide: Y25 (= Y25), Y26 (≠ A26), A78 (≠ P78), T79 (= T79), A80 (≠ G80), S107 (= S107), W109 (≠ M109), Q129 (= Q128), Y131 (= Y130), T157 (= T156), K226 (= K254), H250 (= H278), G251 (= G279), R253 (= R281), D281 (= D309), G282 (= G310), R285 (= R313), G304 (= G332), R305 (= R333)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
34% identity, 97% coverage: 4:371/380 of query aligns to 2:350/359 of 5qigA
- active site: Y129 (= Y130), D157 (= D158), H257 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ A26), A76 (≠ P78), T77 (= T79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), T155 (= T156), K233 (= K254), H257 (= H278), G258 (= G279), R260 (= R281), D288 (= D309), G289 (= G310), G290 (= G311), R292 (= R313), G311 (= G332), R312 (= R333)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: L2 (≠ M4), R223 (≠ K244), G248 (= G269), F320 (≠ A341), K324 (≠ E345), D328 (≠ Q349)
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
34% identity, 97% coverage: 4:371/380 of query aligns to 2:350/359 of 5qifA
- active site: Y129 (= Y130), D157 (= D158), H257 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ A26), A76 (≠ P78), T77 (= T79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), K233 (= K254), H257 (= H278), G258 (= G279), R260 (= R281), D288 (= D309), G289 (= G310), R292 (= R313), G311 (= G332), R312 (= R333)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (≠ K244), R224 (≠ Q245), S227 (≠ G248)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
34% identity, 97% coverage: 4:371/380 of query aligns to 2:350/359 of 2rdwA
- active site: S105 (= S107), Y129 (= Y130), T155 (= T156), D157 (= D158), K233 (= K254), H257 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ A26), A76 (≠ P78), T77 (= T79), A78 (≠ G80), Q127 (= Q128), Y129 (= Y130), T155 (= T156), K233 (= K254), H257 (= H278), G258 (= G279), R260 (= R281), D288 (= D309), G289 (= G310), R292 (= R313), G311 (= G332), R312 (= R333)
- binding sulfate ion: Y23 (= Y25), W107 (≠ M109), R164 (= R165), H257 (= H278), R260 (= R281)
1al8A Three-dimensional structure of glycolate oxidase with bound active- site inhibitors (see paper)
37% identity, 97% coverage: 4:373/380 of query aligns to 3:334/344 of 1al8A
- active site: S106 (= S107), Y129 (= Y130), T155 (= T156), D157 (= D158), K215 (= K254), H239 (= H278)
- binding 3-decyl-2,5-dioxo-4-hydroxy-3-pyrroline: Y24 (= Y25), W108 (≠ M109), Y129 (= Y130), F166 (≠ M173), H239 (= H278), R242 (= R281)
- binding flavin mononucleotide: Y25 (≠ A26), P77 (= P78), T78 (= T79), A79 (≠ G80), S106 (= S107), Q127 (= Q128), Y129 (= Y130), T155 (= T156), K215 (= K254), H239 (= H278), R242 (= R281), D270 (= D309), G271 (= G310), R274 (= R313), G293 (= G332), R294 (= R333)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
34% identity, 97% coverage: 2:371/380 of query aligns to 1:332/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ A26), A77 (≠ P78), T78 (= T79), A79 (≠ G80), S106 (= S107), Q128 (= Q128), Y130 (= Y130), K215 (= K254), H239 (= H278), G240 (= G279), R242 (= R281), D270 (= D309), G271 (= G310), R274 (= R313), G293 (= G332), R294 (= R333)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ M132), K133 (≠ R133), D134 (= D134), N183 (= N206), K190 (≠ S229)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
34% identity, 97% coverage: 4:371/380 of query aligns to 2:344/353 of 5qieA
- active site: Y129 (= Y130), D157 (= D158), H251 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ A26), A76 (≠ P78), T77 (= T79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), K227 (= K254), H251 (= H278), G252 (= G279), R254 (= R281), D282 (= D309), G283 (= G310), R286 (= R313), G305 (= G332), R306 (= R333)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ T5), D322 (≠ Q349)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
34% identity, 97% coverage: 4:371/380 of query aligns to 2:335/344 of 5qihA
- active site: Y129 (= Y130), D157 (= D158), H242 (= H278)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ A26), A76 (≠ P78), T77 (= T79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), K218 (= K254), H242 (= H278), G243 (= G279), R245 (= R281), D273 (= D309), G274 (= G310), R277 (= R313), G296 (= G332), R297 (= R333)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y25), A78 (≠ G80), M79 (≠ L81), W107 (≠ M109), Y129 (= Y130), M180 (≠ L181), L187 (= L223), H242 (= H278)
Query Sequence
>HSERO_RS12985 FitnessBrowser__HerbieS:HSERO_RS12985
MPVMTCVEDFRLLAKKRVPKAFYDYADSGSYTESTYRANSKDLAALKLRQRVAINVDERS
TRTTMIGHDVTMPVAIAPTGLTGMQWANGEMLGAIAAEKFGIPFTLSTMSICSIEDVASV
TTKPFWFQLYVMRDRGFVKSLIERAKAAKCSALVLTLDLQILGQRHKDLKNGMSVPPKLT
LETLLDLASKPGWALRALGGRKTFGNLAGHIKGGEGAGGVQTLSKWTASQFDPTLNWDDV
AWIKQQWGGKLILKGILDVEDAKLAVQSGADAIVVSNHGGRQLDGAMSSIEALPAIAQAV
GDQIEVWFDGGIRSGQDVLKAVALGARGTMIGRAFLYSLGAMGGEGVSQMLEIMRKELDV
SMALTGTKDIKDVGPQILIP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory