Comparing HSERO_RS13085 FitnessBrowser__HerbieS:HSERO_RS13085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
30% identity, 83% coverage: 48:291/294 of query aligns to 46:283/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 73% coverage: 13:226/294 of query aligns to 32:245/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
29% identity, 80% coverage: 53:288/294 of query aligns to 259:510/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
29% identity, 79% coverage: 53:283/294 of query aligns to 244:490/490 of 4ki0F
>HSERO_RS13085 FitnessBrowser__HerbieS:HSERO_RS13085
MDARPAFPTRWFPLLLATPQMLIVFLFFLWPAVKAIAWSFYLVRPFGNGSRFVGLDNYLR
ILTDDSFYASLRATLVFTAGSTLLAVTIALALAACLELDVRAKRLLRSIFIWPYAVAGVV
VGIVLKVLINPVTGLLAFLNQLWPGVWAPHLIGAQAMLALIAAFAWTQVPLNFILFSAAL
QRIPADLMGAAAIDGAGPWRRFIDIQLPMIAPALLLAGVINVIEAFTHGFGLVDALTQGG
PGRSTAILAYQIYSDGFIGLDLSGSSALSVVLMLFIVALTLLQLRFFRQGAGRW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory