SitesBLAST
Comparing HSERO_RS13105 FitnessBrowser__HerbieS:HSERO_RS13105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 92% coverage: 6:412/441 of query aligns to 9:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S270), S275 (= S271), S276 (= S272), T313 (= T308), G353 (= G348), V354 (≠ I349), A357 (≠ S352), G358 (= G353), D394 (≠ S383), R397 (= R386), T398 (≠ A387)
- binding decyl-beta-d-maltopyranoside: L194 (≠ S190), G198 (≠ A194), Y202 (≠ V198)
- binding sodium ion: Y87 (≠ F84), T90 (≠ V87), S91 (= S88), S276 (= S272), G305 (= G300), A306 (≠ Y301), T307 (≠ S302), N309 (= N304), N309 (= N304), M310 (≠ L305), D311 (= D306), S348 (= S343), I349 (≠ K344), G350 (= G345), T351 (≠ A346), N401 (= N390), V402 (≠ T391), D405 (≠ N394)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 92% coverage: 6:412/441 of query aligns to 7:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 92% coverage: 6:412/441 of query aligns to 6:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ S190), G195 (≠ A194), R282 (≠ L280)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S270), S272 (= S271), S273 (= S272), M307 (≠ L305), T310 (= T308), G353 (= G351), A354 (≠ S352), R394 (= R386), T395 (≠ A387)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 92% coverage: 6:412/441 of query aligns to 9:423/426 of 6xwnB
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
28% identity, 92% coverage: 7:410/441 of query aligns to 11:421/425 of O59010
- S65 (≠ T59) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S270) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 270:272) binding
- M311 (≠ L305) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T308) binding
- V355 (≠ I349) binding
- D394 (≠ S383) binding
- M395 (≠ E384) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R386) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N390) binding
- D405 (≠ N394) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
28% identity, 90% coverage: 7:403/441 of query aligns to 2:405/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
28% identity, 91% coverage: 7:408/441 of query aligns to 11:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L40), F46 (≠ L40), P75 (≠ D69), L91 (≠ V86), F95 (≠ V90), L130 (≠ V132), I133 (≠ F135), I159 (≠ V161), Y167 (vs. gap), K196 (≠ S190), G200 (≠ A194), I207 (= I201), F210 (= F204), L250 (≠ I244), I262 (≠ V256), M269 (≠ L263), T334 (= T328), V335 (≠ F329), G336 (≠ V330), T340 (= T334), L343 (≠ G337), M399 (≠ L388)
- binding aspartic acid: S277 (= S271), S278 (= S272), T314 (= T308), G354 (= G348), A358 (≠ S352), G359 (= G353), D394 (≠ S383), R397 (= R386), T398 (≠ A387)
- binding sodium ion: Y89 (≠ F84), T92 (≠ V87), S93 (= S88), G306 (= G300), T308 (≠ S302), N310 (= N304), N310 (= N304), M311 (≠ L305), D312 (= D306), S349 (= S343), I350 (≠ K344), T352 (≠ A346), N401 (= N390), V402 (≠ T391), D405 (≠ N394)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 92% coverage: 6:412/441 of query aligns to 2:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S270), S265 (= S272), M299 (≠ L305), T302 (= T308), T340 (≠ A346), G342 (= G348), V343 (≠ I349), G347 (= G353), D383 (≠ S383), R386 (= R386), T387 (≠ A387), N390 (= N390)
- binding decyl-beta-d-maltopyranoside: H23 (= H28), V212 (≠ L219), A216 (= A223)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
28% identity, 90% coverage: 7:403/441 of query aligns to 8:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G63), V83 (≠ L81), I157 (≠ L162), Y164 (vs. gap), K193 (≠ S190), T305 (≠ S302), I306 (≠ F303), I347 (≠ K344)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L12), M199 (= M196), S275 (= S272), T311 (= T308), G356 (= G353), L384 (= L376), D391 (≠ S383), R394 (= R386)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
28% identity, 91% coverage: 7:406/441 of query aligns to 3:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 90% coverage: 7:403/441 of query aligns to 3:406/408 of 6bauA
- binding cysteine: S270 (= S272), M303 (≠ L305), T306 (= T308), A345 (= A347), G346 (= G348), V347 (≠ I349), G351 (= G353), D386 (≠ S383), C389 (≠ R386), T390 (≠ A387), N393 (= N390)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
26% identity, 90% coverage: 7:403/441 of query aligns to 3:394/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 89% coverage: 20:411/441 of query aligns to 34:409/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V73), G89 (= G74), G92 (= G77), A95 (= A80), V96 (≠ L81), Y99 (≠ F84), M163 (= M144), F167 (= F165), F293 (≠ L295), V297 (≠ T299)
- binding aspartic acid: S268 (= S271), S269 (= S272), T306 (= T308), G346 (= G348), I347 (= I349), A350 (≠ S352), G351 (= G353), D380 (≠ S383), R383 (= R386), T384 (≠ A387)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 89% coverage: 20:411/441 of query aligns to 26:395/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I64), S80 (≠ V73), G81 (= G74), G84 (= G77), Y91 (≠ F84), M156 (= M144), F160 (= F165), F286 (≠ L295), V290 (≠ T299)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I56), I148 (≠ V136), S262 (= S272), S263 (≠ E273), A292 (≠ Y301), T293 (≠ S302), M296 (≠ L305), T299 (= T308), G329 (= G345), A336 (≠ S352), G337 (= G353), D366 (≠ S383), R369 (= R386), N373 (= N390)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 84% coverage: 41:410/441 of query aligns to 47:420/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S271), S281 (= S272), T318 (= T308), G363 (= G353), M367 (≠ L357), V385 (≠ L376), D388 (= D379), R395 (= R386), T396 (≠ A387)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R380)
- binding cholesterol hemisuccinate: R80 (≠ K75), R84 (≠ L79), I95 (≠ V90), I252 (≠ V240)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 84% coverage: 41:410/441 of query aligns to 46:421/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 80% coverage: 41:394/441 of query aligns to 39:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T59), L58 (≠ V60), L65 (≠ M67), V339 (≠ K344), G340 (= G345), S343 (≠ G348), I344 (= I349)
- binding cholesterol: W188 (≠ K197), I227 (vs. gap), F250 (≠ V256), W257 (≠ L263), M379 (≠ A385), S382 (≠ L388)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S272), M300 (≠ L305), T303 (= T308), Y306 (= Y311), G348 (= G353), L349 (≠ F354), M352 (≠ L357), I366 (≠ L372), L369 (≠ I375), V370 (≠ L376), D373 (= D379), D377 (≠ S383), R380 (= R386), T381 (≠ A387), N384 (= N390)
Sites not aligning to the query:
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
30% identity, 81% coverage: 54:411/441 of query aligns to 106:492/541 of Q15758
- N212 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 512 V → L: in dbSNP:rs3027961
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
26% identity, 91% coverage: 41:441/441 of query aligns to 82:529/573 of P31596
- K298 (= K213) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (vs. gap) mutation H->N,T,K,R: No transporter activity.
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
31% identity, 77% coverage: 54:394/441 of query aligns to 60:429/442 of 7bcsA
Query Sequence
>HSERO_RS13105 FitnessBrowser__HerbieS:HSERO_RS13105
MTAQKPPLYKSLYFQVLVAIVIGILLGHFYPSTGEAMKPLGDGFVKLIKMIIAPVIFCTV
VIGIAGMEDMKKVGKTGGLALLYFEVVSTVALIIGLLLVNFLQPGVGMNVDPASLDTKSI
AAYTAPGKMGSVTDFVLGIIPTSMVDAFAKGDVLQVLLVAVLFGFALHKFGGRGTLVFDF
IEKISHVLFSVVGAIMKVAPIGAFGAMSFTIGKYGVGSLFSLAKLMGTFYLTCLLFIFVV
LGIITRLHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMLAKMENAGAKKTVVGLVIPTG
YSFNLDGTAIYLTMAAVFIAQATNTPMTFVQELTLLGVLLLTSKGAAGITGSGFIVLAAT
LSAVGHVPVAGLALILGIDRFMSEARALTNTIGNGVATLVVAKWSGELDSERLTKVLNNE
TVEDAQAPESILDRTDAKMHH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory