Comparing HSERO_RS13585 FitnessBrowser__HerbieS:HSERO_RS13585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 90% coverage: 1:296/329 of query aligns to 1:289/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
32% identity, 90% coverage: 2:296/329 of query aligns to 1:288/311 of 1pz0A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 90% coverage: 1:297/329 of query aligns to 1:291/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
31% identity, 90% coverage: 1:297/329 of query aligns to 1:291/333 of 1pz1A
8hw0A The structure of akr6d1
32% identity, 96% coverage: 1:316/329 of query aligns to 1:318/329 of 8hw0A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
26% identity, 96% coverage: 1:316/329 of query aligns to 2:287/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
26% identity, 96% coverage: 1:316/329 of query aligns to 2:287/298 of 1ynpB
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
26% identity, 96% coverage: 1:316/329 of query aligns to 2:272/283 of 1ynpA
Sites not aligning to the query:
7ezlA Rice l-galactose dehydrogenase (holo form)
27% identity, 100% coverage: 1:329/329 of query aligns to 3:311/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
27% identity, 100% coverage: 1:329/329 of query aligns to 8:316/323 of 7eziA
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
34% identity, 61% coverage: 10:210/329 of query aligns to 13:203/281 of 5c7hA
Sites not aligning to the query:
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
34% identity, 61% coverage: 10:210/329 of query aligns to 13:203/281 of 4pmjA
Sites not aligning to the query:
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
26% identity, 98% coverage: 1:322/329 of query aligns to 1:315/337 of Q3L181
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
28% identity, 92% coverage: 1:302/329 of query aligns to 1:302/323 of 6ow0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
28% identity, 92% coverage: 1:302/329 of query aligns to 1:278/301 of 6ow0B
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
25% identity, 90% coverage: 1:295/329 of query aligns to 13:291/315 of 5t79A
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
27% identity, 95% coverage: 1:311/329 of query aligns to 11:316/335 of 4aubB
Sites not aligning to the query:
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
29% identity, 68% coverage: 1:225/329 of query aligns to 2:222/275 of 6kiyA
Sites not aligning to the query:
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
29% identity, 68% coverage: 1:225/329 of query aligns to 2:222/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
29% identity, 68% coverage: 1:225/329 of query aligns to 1:221/274 of 5danA
Sites not aligning to the query:
>HSERO_RS13585 FitnessBrowser__HerbieS:HSERO_RS13585
MKSRRFGRTGAQVSEIGFGAWAIGGSWGDVSAQDAKAALHAALDAGVSFIDTADVYGDGR
SEQLIAQVLKERGGERPFVATKAGRRLSPHVASGYNDRAQLSAFIDRSLKNLGVDCLDLV
QLHCPPTEVYYQQEVFGHLDALVAAGKIRHYGVSVEKVEEALKAIEYPNVKSVQIIFNIF
RQRPISLFLQEAQRRDIAVIARVPLASGLLTGKMSAQTTFAADDHRQFNRHGEAFDVGET
FSGVPYEVALAAVEKIRALVPQGVPMAQFALRWILMESGISTVIPGARNVAQAQSNSAAS
ALPPITAEVMQALRAIYLHDIAPYVHQRW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory