SitesBLAST
Comparing HSERO_RS13590 FitnessBrowser__HerbieS:HSERO_RS13590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
54% identity, 99% coverage: 4:306/307 of query aligns to 5:307/309 of Q53TZ2
- D169 (= D168) mutation to A: Loss of activity.
- N173 (= N172) mutation to A: Decrease by 4 orders of magnitude in catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
54% identity, 99% coverage: 4:306/307 of query aligns to 2:304/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K90), H116 (= H118), H150 (= H152), P167 (= P169), N170 (= N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), K11 (= K13), I12 (= I14), S34 (= S36), R35 (= R37), H36 (≠ N38), C64 (= C66), A65 (≠ M67), P66 (= P68), V69 (≠ Y71), E87 (= E89), K88 (= K90), H116 (= H118), Q153 (= Q155), W155 (= W157), D166 (= D168), Y263 (= Y265)
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
22% identity, 96% coverage: 1:296/307 of query aligns to 1:308/325 of 1zh8A
- active site: K98 (= K90), H187 (≠ N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), C11 (≠ V11), G12 (= G12), I13 (≠ K13), A14 (≠ I14), S37 (= S36), R38 (= R37), T39 (≠ N38), H42 (vs. gap), T74 (≠ C66), L75 (≠ M67), P76 (= P68), L79 (≠ Y71), E97 (= E89), K98 (= K90), N126 (≠ H118), Y165 (≠ H150), W170 (= W157), R171 (≠ I158), H187 (≠ N172), Y276 (= Y265)
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
28% identity, 43% coverage: 1:133/307 of query aligns to 1:140/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), A13 (≠ K13), Q14 (≠ I14), D36 (vs. gap), S37 (vs. gap), R41 (vs. gap), A73 (≠ C66), G74 (≠ M67), L78 (≠ Y71), E96 (= E89), K97 (= K90), N125 (≠ H118)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
30% identity, 65% coverage: 46:246/307 of query aligns to 51:256/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F152 (≠ W144), N154 (≠ E146), D175 (= D168), L176 (≠ P169), H179 (≠ N172), E236 (≠ Q228)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T70 (≠ C66), T71 (≠ M67), P72 (= P68), N73 (≠ P69), L75 (≠ Y71), H76 (≠ R72), Q79 (≠ A75), E93 (= E89), K94 (= K90), N122 (≠ H118), W161 (= W157), H179 (≠ N172)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 11, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 10, 11, 12, 33, 34, 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
30% identity, 65% coverage: 46:246/307 of query aligns to 51:256/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: N154 (≠ E146), D175 (= D168), H179 (≠ N172), E236 (≠ Q228)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T70 (≠ C66), T71 (≠ M67), P72 (= P68), N73 (≠ P69), L75 (≠ Y71), H76 (≠ R72), Q79 (≠ A75), E93 (= E89), K94 (= K90), N122 (≠ H118), W161 (= W157)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 11, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 8, 10, 11, 12, 33, 34, 290
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
30% identity, 65% coverage: 46:246/307 of query aligns to 51:256/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: T70 (≠ C66), T71 (≠ M67), P72 (= P68), N73 (≠ P69), L75 (≠ Y71), H76 (≠ R72), Q79 (≠ A75), E93 (= E89), K94 (= K90), N122 (≠ H118), W161 (= W157), H179 (≠ N172)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
23% identity, 57% coverage: 7:181/307 of query aligns to 37:228/383 of 1h6dA
- active site: K131 (= K90), Y219 (≠ N172)
- binding glycerol: K131 (= K90), R202 (≠ I158), D215 (= D168), Y219 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G10), L41 (≠ V11), G42 (= G12), K43 (= K13), Y44 (≠ I14), S66 (= S36), G67 (≠ R37), K71 (vs. gap), Y89 (vs. gap), I107 (≠ C66), L108 (≠ M67), P109 (= P68), N110 (≠ P69), H113 (≠ R72), E130 (= E89), K131 (= K90), R159 (≠ H118), A198 (≠ D154), W201 (= W157), R202 (≠ I158), Y219 (≠ N172)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
23% identity, 57% coverage: 7:181/307 of query aligns to 35:226/381 of 1rydA
- active site: K129 (= K90), Y217 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ V11), G40 (= G12), K41 (= K13), Y42 (≠ I14), S64 (= S36), G65 (≠ R37), K69 (vs. gap), Y87 (vs. gap), L106 (≠ M67), P107 (= P68), N108 (≠ P69), L110 (≠ Y71), H111 (≠ R72), E128 (= E89), K129 (= K90), R157 (≠ H118), A196 (≠ D154), W199 (= W157), R200 (≠ I158), Y217 (≠ N172)
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 50% coverage: 4:157/307 of query aligns to 3:172/322 of 3q2kK
- active site: K95 (= K90)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ K13), K95 (= K90), T155 (≠ R145), R156 (≠ E146), Y160 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G11 (= G12), R12 (≠ K13), I13 (= I14), D35 (≠ S36), T36 (≠ R37), T72 (≠ M67), P73 (= P68), S74 (≠ P69), L76 (≠ Y71), H77 (≠ R72), E94 (= E89), K95 (= K90), Q123 (≠ H118), W166 (= W151), R167 (≠ H152)
Sites not aligning to the query:
- active site: 183
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 179, 180, 183, 239
- binding 1,4-dihydronicotinamide adenine dinucleotide: 183
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 50% coverage: 4:157/307 of query aligns to 8:177/347 of 3q2kC
- active site: K100 (= K90)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ K13), K100 (= K90), W159 (= W144), T160 (≠ R145), R161 (≠ E146), Y165 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G12), R17 (≠ K13), I18 (= I14), D40 (≠ S36), T41 (≠ R37), A76 (≠ C66), T77 (≠ M67), S79 (≠ P69), H82 (≠ R72), Q85 (≠ A75), E99 (= E89), K100 (= K90), Q128 (≠ H118), W171 (= W151), R172 (≠ H152)
Sites not aligning to the query:
- active site: 188
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 184, 185, 188, 243, 244
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
23% identity, 57% coverage: 7:181/307 of query aligns to 6:197/340 of 1evjA
- active site: K100 (= K90), Y188 (≠ N172)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), L10 (≠ V11), G11 (= G12), K12 (= K13), Y13 (≠ I14), D35 (≠ S36), L77 (≠ M67), P78 (= P68), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W170 (= W157), R171 (≠ I158), Y188 (≠ N172)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
30% identity, 39% coverage: 4:123/307 of query aligns to 4:129/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), R13 (≠ K13), A14 (≠ V15), D35 (≠ S36), P36 (≠ R37), R37 (≠ N38), A71 (≠ C66), S72 (≠ M67), P73 (= P68), F76 (≠ Y71), Q80 (≠ A75), E94 (= E89), K95 (= K90), P96 (= P91)
Sites not aligning to the query:
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
21% identity, 89% coverage: 4:276/307 of query aligns to 3:292/325 of 3rc1A
- active site: K95 (= K90), Y179 (≠ N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ V11), A11 (≠ G12), D12 (≠ K13), I13 (= I14), S35 (= S36), R36 (= R37), Y56 (= Y47), P71 (≠ C66), L72 (≠ M67), P73 (= P68), H77 (≠ R72), E94 (= E89), K95 (= K90), I162 (≠ W157), R163 (≠ I158), V168 (vs. gap), D175 (= D168), Y179 (≠ N172)
- binding phosphate ion: H278 (≠ E262), K283 (≠ S267)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ D17), R17 (≠ Q18), F152 (≠ D147), I154 (≠ R149), P155 (≠ H150), Y233 (vs. gap), T253 (≠ E235)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
21% identity, 89% coverage: 4:276/307 of query aligns to 10:299/332 of B3TMR8
- 17:23 (vs. 11:17, 14% identical) binding
- SR 42:43 (= SR 36:37) binding
- Y63 (= Y47) binding
- L79 (≠ M67) binding
- H84 (≠ R72) binding
- K102 (= K90) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (≠ I158) binding
- D182 (= D168) binding
- Y186 (≠ N172) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
34% identity, 27% coverage: 42:124/307 of query aligns to 45:127/332 of 2glxA
Sites not aligning to the query:
- active site: 179
- binding acetate ion: 179
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 7, 8, 9, 10, 11, 32, 33, 37, 161, 162, 282
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
34% identity, 27% coverage: 42:124/307 of query aligns to 46:128/333 of Q2I8V6
- TTNELH 71:76 (≠ MPPQYR 67:72) binding
- EK 93:94 (= EK 89:90) binding
- K94 (= K90) mutation to G: Less than 1% remaining activity.
- N120 (≠ S116) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
3e18A Crystal structure of NAD-binding protein from listeria innocua
25% identity, 77% coverage: 5:240/307 of query aligns to 5:230/348 of 3e18A
- active site: K94 (= K90), H178 (≠ N172)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G13 (≠ K13), M14 (≠ I14), F34 (= F29), D35 (≠ K30), I36 (≠ L31), K40 (≠ A35), A70 (≠ C66), T71 (≠ M67), P72 (= P68), N73 (≠ P69), H76 (≠ R72), E93 (= E89), K94 (= K90), N122 (≠ H118), W161 (= W144), R162 (= R145), H178 (≠ N172)
7xr9A Crystal structure of dgpa with glucose (see paper)
25% identity, 38% coverage: 18:134/307 of query aligns to 19:135/344 of 7xr9A
Sites not aligning to the query:
Query Sequence
>HSERO_RS13590 FitnessBrowser__HerbieS:HSERO_RS13590
MTAIQLAIAGVGKIVYDQHAPAIAGNTDFKLVATASRNHSIDGVTAYKSMAEMLASGTAI
DAISLCMPPQYRYEAAREAIRAGKHVFLEKPPGATLSEVESLRDLAAEQGVTLFASWHSR
HAPAVQVVKRHLQQHAPRQVKVIWREDVRHWHPDQEWIWQPGGLGVFDPGINALSIVTEI
LPQAMFLKQAALEVPSNRQTPIAARLAFTDALGTDVQADFDWRQTGGQTWDIIIETGSTH
VHLKKGGHELWIDGKQSELPVEGEYPSLYQHFCQLIRKHASDVDVAPLRHVADAFMLGEH
IVTDAFV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory