Comparing HSERO_RS13690 FitnessBrowser__HerbieS:HSERO_RS13690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
37% identity, 90% coverage: 41:417/418 of query aligns to 17:388/412 of 7ru7A
6knhC Crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
29% identity, 89% coverage: 44:413/418 of query aligns to 20:378/384 of 6knhC
6kniA Crystal structure of sbnh in complex with the cofactor plp, a plp- dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
28% identity, 89% coverage: 44:413/418 of query aligns to 20:374/381 of 6kniA
6knkA Crystal structure of sbnh in complex with citryl-diaminoethane (see paper)
28% identity, 89% coverage: 44:413/418 of query aligns to 21:376/383 of 6knkA
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
29% identity, 86% coverage: 41:401/418 of query aligns to 13:361/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
28% identity, 86% coverage: 41:401/418 of query aligns to 11:354/394 of 3c5qA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 92% coverage: 19:401/418 of query aligns to 13:394/438 of Q58497
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
28% identity, 92% coverage: 19:401/418 of query aligns to 9:390/434 of 1tufA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
28% identity, 92% coverage: 19:401/418 of query aligns to 9:390/434 of 1twiA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
29% identity, 95% coverage: 21:418/418 of query aligns to 8:392/418 of 4xg1B
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
28% identity, 93% coverage: 29:418/418 of query aligns to 1:362/386 of Q9X1K5
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
28% identity, 94% coverage: 24:418/418 of query aligns to 9:367/393 of 4xg1A
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
28% identity, 92% coverage: 33:418/418 of query aligns to 4:361/385 of 2yxxA
2pljA Crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus (see paper)
26% identity, 88% coverage: 42:407/418 of query aligns to 30:361/376 of 2pljA
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
28% identity, 94% coverage: 22:412/418 of query aligns to 21:419/446 of 1hkvA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
28% identity, 94% coverage: 22:412/418 of query aligns to 22:420/447 of P9WIU7
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
27% identity, 93% coverage: 21:408/418 of query aligns to 10:388/422 of 6n2aA
2plkA Crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus (see paper)
26% identity, 88% coverage: 42:407/418 of query aligns to 26:356/370 of 2plkA
1f3tB Crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product. (see paper)
26% identity, 92% coverage: 32:414/418 of query aligns to 10:363/381 of 1f3tB
1njjA Crystal structure determination of t. Brucei ornithine decarboxylase bound to d-ornithine and to g418 (see paper)
27% identity, 90% coverage: 33:407/418 of query aligns to 3:341/349 of 1njjA
>HSERO_RS13690 FitnessBrowser__HerbieS:HSERO_RS13690
MHADPRQKPLHAEQTAFPIVDGMLHVGGMPLDRLALRVGATPFYVYDRALLRARVAHLRA
HLPAELALHYSIKANPMPALVQAMAQLVDGFDVASGGELATALDTPMPVQHISFTGPGKS
LAELRRALAAGVMLHVESEREAEAVAALAQELGVRPGVTLRINPPFELKSSGMRMGGGAK
PFGVDAEAAPALLRWLAGQGVQVAGLQIFCGSQSLDAQAIMAAQSSSFELALQLAGEAGL
SLRVLNIGGGFGIPYFPGERALEIAPIGAHLAQWLPRLRALHPQLRVVMEMGRYLVGEAG
LYVSRVIDRKQSRGEVFLVVDGGLHHHLAASGNFGQVIRKNYPVTIVPQQPQRSGGGTTE
RVSVVGPLCTPLDVLAAQMLLPAAAVGDLVVVFQSGAYGLSASPTAFLGHPAPAEVLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory