Comparing HSERO_RS13940 FitnessBrowser__HerbieS:HSERO_RS13940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
34% identity, 89% coverage: 20:368/390 of query aligns to 28:358/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
26% identity, 98% coverage: 2:383/390 of query aligns to 7:361/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
27% identity, 98% coverage: 2:383/390 of query aligns to 8:356/360 of 2f7vA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 82% coverage: 65:383/390 of query aligns to 60:374/380 of 5vo3A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
30% identity, 71% coverage: 67:343/390 of query aligns to 57:330/377 of 7t1qA
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 82% coverage: 65:383/390 of query aligns to 56:370/377 of P44514
7lgpB Dape enzyme from shigella flexneri
27% identity, 82% coverage: 71:389/390 of query aligns to 63:377/377 of 7lgpB
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 76% coverage: 73:370/390 of query aligns to 72:364/383 of 7uoiA
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 56% coverage: 62:281/390 of query aligns to 66:292/407 of P37111
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 55% coverage: 71:284/390 of query aligns to 99:313/426 of 3pfoA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 56% coverage: 62:281/390 of query aligns to 66:293/408 of Q03154
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
29% identity, 50% coverage: 71:264/390 of query aligns to 62:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
29% identity, 50% coverage: 71:264/390 of query aligns to 62:258/375 of 4pqaA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
40% identity, 27% coverage: 65:171/390 of query aligns to 58:168/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
38% identity, 26% coverage: 71:171/390 of query aligns to 62:166/265 of 4op4B
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 39% coverage: 5:157/390 of query aligns to 22:181/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
38% identity, 23% coverage: 67:157/390 of query aligns to 123:212/507 of Q96KN2
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
39% identity, 21% coverage: 62:143/390 of query aligns to 60:144/192 of 1q7lA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
29% identity, 39% coverage: 71:221/390 of query aligns to 86:245/458 of 2pokA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
37% identity, 22% coverage: 71:155/390 of query aligns to 94:177/475 of Q96KP4
Sites not aligning to the query:
>HSERO_RS13940 FitnessBrowser__HerbieS:HSERO_RS13940
MNTRQWLETLVAFDTTSRNSNLELITTVRDSLQQQGVASWLAHNKDKTKANLFATLPATA
GPHAGSTEGGIVLSGHTDVVPVDGQKWDTDPFKLTEKDGALYARGSCDMKGFIATALALV
PEYLAMPRVKPIHLAFSFDEEIGCIGAPVMLEEIVKRGIKVDGCVVGEPTSMNVVVAHKG
INVFACKVHGKSAHSSLTPQGCNAIEHAARLICAIRDFADGYKANGPYDQFFDVPFSTMT
TNQIRGGIAVNTIPELCEFTYEFRNLPGMSVADIQAQIDKYIAEVLLPKMRTEFPDARVE
IDNFAGSPALEAVEQAAITELVRALTGDRQTRKVAYGTEAGLFQQIGIPTIVCGPGDIGN
AHKPNEFVTLAQMEHCEQFLRKLGKSLQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory