Comparing HSERO_RS14035 FitnessBrowser__HerbieS:HSERO_RS14035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
40% identity, 96% coverage: 8:337/344 of query aligns to 2:336/336 of A3QCW5
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
32% identity, 90% coverage: 32:339/344 of query aligns to 3:309/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
32% identity, 90% coverage: 32:339/344 of query aligns to 3:309/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
32% identity, 90% coverage: 32:339/344 of query aligns to 3:309/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
32% identity, 90% coverage: 32:339/344 of query aligns to 3:309/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
32% identity, 90% coverage: 32:339/344 of query aligns to 4:310/310 of 7bbrA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
32% identity, 87% coverage: 35:332/344 of query aligns to 3:297/303 of 4pddA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
33% identity, 85% coverage: 42:332/344 of query aligns to 13:300/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
33% identity, 85% coverage: 42:332/344 of query aligns to 12:299/303 of 4p9kA
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
33% identity, 71% coverage: 52:294/344 of query aligns to 20:261/304 of 4xeqB
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
31% identity, 85% coverage: 37:329/344 of query aligns to 6:304/314 of 4p8bA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
33% identity, 86% coverage: 36:332/344 of query aligns to 4:297/301 of 4pdhA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
29% identity, 82% coverage: 52:332/344 of query aligns to 25:297/300 of 7t3eA
Sites not aligning to the query:
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
29% identity, 82% coverage: 35:316/344 of query aligns to 3:282/301 of 4x04A
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
27% identity, 84% coverage: 34:323/344 of query aligns to 4:290/304 of 4x8rA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
28% identity, 78% coverage: 56:322/344 of query aligns to 24:286/300 of 4n8yA
Sites not aligning to the query:
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
28% identity, 82% coverage: 51:332/344 of query aligns to 19:296/299 of 7a5qB
Sites not aligning to the query:
7a5qA Crystal structure of vcsiap bound to sialic acid (see paper)
28% identity, 82% coverage: 51:332/344 of query aligns to 19:296/299 of 7a5qA
Sites not aligning to the query:
4magA Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea (see paper)
28% identity, 82% coverage: 51:332/344 of query aligns to 19:296/307 of 4magA
Sites not aligning to the query:
A3T0D1 Solute-binding protein NAS141_03721 from Sulfitobacter sp. (strain NAS-14.1) (see paper)
29% identity, 82% coverage: 50:332/344 of query aligns to 45:327/330 of A3T0D1
>HSERO_RS14035 FitnessBrowser__HerbieS:HSERO_RS14035
MTILPLRTALAACAFVTLGLPQPAALAQQPQQPIIIKFSHVVANDTPKGKGAERFKELAE
KATQGRVKVEVYPNSTLYKDKEELEALQLGSVQMLAPSLAKFGPLGAREFEVFDLPYIFP
DKAVLKRVTEGPIGQGLFQKLEGKGIKGLAYWDNGMKVMTANRPLHKVADFRALKMRIQS
SKVLDEQFRALKANPQVLAFSEVYQAMQTGVVDGSENTPSNVYTQKMHEVQSNLTVSDHG
YIGYAVIVNKKFWEALPADIRSQLEAAMKQATLYANTIAQKENDDALAAIKASGKTRVYT
LSEQEKAEWRRALLPVHKSMAARVGADLIEAIYKESEAAGVKMN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory