SitesBLAST
Comparing HSERO_RS14225 FitnessBrowser__HerbieS:HSERO_RS14225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
44% identity, 94% coverage: 14:355/364 of query aligns to 53:390/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L144), R200 (= R164), M281 (≠ R246), G282 (= G247), R307 (= R272), A308 (≠ P273), Q320 (= Q285), V321 (= V286), G322 (= G287), Q323 (= Q288), T324 (≠ S289), G337 (= G302), I338 (= I303), S339 (= S304), Q343 (= Q308), H344 (= H309), N358 (= N323), K359 (≠ S324), L377 (≠ A342)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
49% identity, 91% coverage: 29:358/364 of query aligns to 7:332/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (= T145), R140 (= R164), T142 (= T166), G219 (= G245), K220 (≠ R246), G221 (= G247), S245 (≠ T271), R246 (= R272), A247 (≠ P273), Q259 (= Q285), V260 (= V286), G261 (= G287), Q262 (= Q288), T263 (≠ S289), G276 (= G302), S278 (= S304), Q282 (= Q308), H283 (= H309), N297 (= N323), I298 (≠ S324), L316 (≠ A342)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
42% identity, 91% coverage: 27:356/364 of query aligns to 11:338/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L144), R144 (= R164), I155 (= I175), G224 (= G245), R225 (= R246), G226 (= G247), S250 (≠ T271), R251 (= R272), A252 (≠ P273), Q264 (= Q285), V265 (= V286), G266 (= G287), Q267 (= Q288), S268 (= S289), G281 (= G302), I282 (= I303), S283 (= S304), S285 (≠ A306), Q287 (= Q308), H288 (= H309), N302 (= N323), K303 (≠ S324), D320 (≠ N341), A321 (= A342)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
40% identity, 88% coverage: 29:349/364 of query aligns to 4:320/331 of 5ol2A
- binding calcium ion: E75 (≠ Q103), D188 (= D216)
- binding flavin-adenine dinucleotide: T117 (= T145), R136 (= R164), I147 (= I175), G216 (= G245), R217 (= R246), G218 (= G247), S242 (≠ T271), R243 (= R272), A244 (≠ P273), Q256 (= Q285), V257 (= V286), G258 (= G287), T260 (≠ S289), G273 (= G302), I274 (= I303), S275 (= S304), A277 (= A306), Q279 (= Q308), H280 (= H309), N294 (= N323), K295 (≠ S324), D312 (≠ N341), V313 (≠ A342)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
39% identity, 92% coverage: 16:349/364 of query aligns to 2:327/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L144), T126 (= T145), R144 (= R164), I155 (= I175), R224 (= R246), G225 (= G247), T249 (= T271), R250 (= R272), Q263 (= Q285), I264 (≠ V286), G265 (= G287), L266 (≠ Q288), S267 (= S289), G280 (= G302), I281 (= I303), S282 (= S304), Q286 (= Q308), N301 (= N323), S302 (= S324), D303 (= D325), D319 (≠ N341), L320 (≠ A342)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
30% identity, 95% coverage: 10:356/364 of query aligns to 3:333/333 of P13804
- 20:204 (vs. 27:222, 17% identical) Domain I
- G116 (= G129) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ R190) to I: decreased protein stability; dbSNP:rs1801591
- 205:333 (vs. 228:356, 53% identical) Domain II
- R223 (= R246) binding
- S248 (≠ T271) binding
- R249 (= R272) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (≠ VGQS 286:289) binding
- T266 (≠ S289) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 304:309) binding
- N300 (= N323) binding
- DL 318:319 (≠ NA 341:342) binding
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
30% identity, 91% coverage: 26:356/364 of query aligns to 1:315/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G245), R205 (= R246), S230 (≠ T271), R231 (= R272), A232 (≠ P273), Q244 (= Q285), V245 (= V286), G246 (= G287), T248 (≠ S289), G261 (= G302), I262 (= I303), S263 (= S304), A265 (= A306), Q267 (= Q308), H268 (= H309), N282 (= N323), K283 (≠ S324), D300 (≠ N341), L301 (≠ A342)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
52% identity, 34% coverage: 229:350/364 of query aligns to 183:304/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G245), R200 (= R246), G201 (= G247), S225 (≠ T271), R226 (= R272), A227 (≠ P273), Q239 (= Q285), V240 (= V286), G241 (= G287), T243 (≠ S289), G256 (= G302), I257 (= I303), S258 (= S304), A260 (= A306), Q262 (= Q308), H263 (= H309), N277 (= N323), K278 (≠ S324), D295 (≠ N341), L296 (≠ A342)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
29% identity, 79% coverage: 69:354/364 of query aligns to 27:292/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G245), R184 (= R246), G185 (= G247), S209 (≠ T271), R210 (= R272), Q223 (= Q285), I224 (≠ V286), G225 (= G287), T227 (≠ S289), G240 (= G302), V241 (≠ I303), S242 (= S304), A244 (= A306), Q246 (= Q308), H247 (= H309), N261 (= N323), K262 (≠ S324), D279 (≠ N341), Y280 (≠ A342)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
28% identity, 90% coverage: 29:357/364 of query aligns to 4:319/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
28% identity, 90% coverage: 29:357/364 of query aligns to 3:318/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G245), R210 (= R246), G211 (= G247), S235 (≠ T271), A236 (≠ R272), P237 (= P273), Q249 (= Q285), V250 (= V286), G251 (= G287), Q252 (= Q288), S253 (= S289), G267 (= G302), I268 (= I303), S269 (= S304), S271 (≠ A306), Q273 (= Q308), H274 (= H309), N288 (= N323), T289 (≠ S324), D306 (≠ N341), I307 (≠ A342)
Query Sequence
>HSERO_RS14225 FitnessBrowser__HerbieS:HSERO_RS14225
MNQEKPAPERKGGKGKYELDERLKAYQGVWVFIEHERGEVHPVSWELLGEGRKLADQLGV
SLSGVVLGAPDLATRQFCEQAFHHGADSCYLMADPTLSAYRNQPFTKGLTDLVNRYQPEI
LLLGATAQGRDLAGSVATTLKTGLTADCTGLTIDMENRSMAASRPTFGGSLLCTILTLNY
RPQMATVRPRVMAMPEPDRSRSGQIIEHPLCLVESDIITKVLEYIPDNQQDKPQLPFADI
IVAGGRGMKRAENFQLIWDLAMVLGAEVGATRPVVQANWVQAERQVGQSGKTVRPKLYIA
AGISGAIQHRVGMADSDVIIAINSDPNAPIFDFASYGIVGNAMTILPALTEAFRQQLTTM
RMAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory