SitesBLAST
Comparing HSERO_RS14995 FitnessBrowser__HerbieS:HSERO_RS14995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
37% identity, 97% coverage: 13:392/392 of query aligns to 11:397/398 of 8sadA
- binding magnesium ion: A359 (≠ K356), R362 (= R359), A365 (≠ W362)
- binding pyridoxal-5'-phosphate: C88 (≠ S89), G89 (= G90), A90 (≠ L91), Y114 (= Y115), D188 (= D187), A210 (= A209), T212 (= T211), K213 (= K212), M222 (≠ L221), W343 (= W343)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
37% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), D181 (= D187), T205 (= T211), K206 (= K212), M215 (≠ L221), W336 (= W343)
- binding serine: Y107 (= Y115), K206 (= K212), Y334 (= Y341), S335 (= S342), W336 (= W343), R368 (= R370)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
37% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 8u98A
- binding glycine: Y107 (= Y115), K206 (= K212), Y334 (= Y341), S335 (= S342), W336 (= W343), R368 (= R370)
- binding pyridoxal-5'-phosphate: Y52 (= Y60), R54 (≠ L62), C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), W336 (= W343)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
37% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), W336 (= W343)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), S335 (= S342), W336 (= W343), R368 (= R370)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
37% identity, 97% coverage: 13:392/392 of query aligns to 5:391/392 of 8sabA
- binding lysine: N9 (≠ H17), R12 (≠ Y20), R13 (= R21), K14 (≠ A22), T17 (≠ G25), L330 (= L336), E341 (≠ H347)
- binding pyridoxal-5'-phosphate: C82 (≠ S89), G83 (= G90), A84 (≠ L91), Y108 (= Y115), D182 (= D187), A204 (= A209), T206 (= T211), K207 (= K212), M216 (≠ L221), W337 (= W343)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S89), G83 (= G90), A84 (≠ L91), Y108 (= Y115), D182 (= D187), A204 (= A209), T206 (= T211), K207 (= K212), M216 (≠ L221), Y335 (= Y341), S336 (= S342), W337 (= W343), R369 (= R370)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 97% coverage: 13:392/392 of query aligns to 8:394/395 of P06721
- K210 (= K212) modified: N6-(pyridoxal phosphate)lysine
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
35% identity, 97% coverage: 13:392/392 of query aligns to 5:391/392 of 1cl1B
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
35% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 2gqnA
- active site: R54 (≠ L62), Y107 (= Y115), D181 (= D187), K206 (= K212)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), E108 (≠ G116), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), Y334 (= Y341), S335 (= S342), W336 (= W343), R368 (= R370)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
35% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 2fq6A
- active site: R54 (≠ L62), Y107 (= Y115), D181 (= D187), K206 (= K212)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), P109 (= P117), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), Y334 (= Y341), S335 (= S342), W336 (= W343), R368 (= R370)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
35% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 1cl2A
- active site: R54 (≠ L62), Y107 (= Y115), D181 (= D187), K206 (= K212)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), Y334 (= Y341), S335 (= S342), W336 (= W343), R368 (= R370)
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
35% identity, 97% coverage: 13:392/392 of query aligns to 4:390/391 of 4itxA
- active site: R54 (≠ L62), Y107 (= Y115), D181 (= D187), K206 (= K212)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S89), G82 (= G90), A83 (≠ L91), Y107 (= Y115), D181 (= D187), A203 (= A209), T205 (= T211), K206 (= K212), M215 (≠ L221), Y334 (= Y341), S335 (= S342), W336 (= W343), R368 (= R370)
1e5fA Methionine gamma-lyase (mgl) from trichomonas vaginalis
29% identity, 98% coverage: 9:392/392 of query aligns to 3:392/393 of 1e5fA
- active site: R55 (≠ L62), Y108 (= Y115), D181 (= D187), K206 (= K212)
- binding pyridoxal-5'-phosphate: Y53 (= Y60), R55 (≠ L62), G83 (= G90), M84 (≠ L91), Y108 (= Y115), D181 (= D187), S203 (≠ A209), K206 (= K212)
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
29% identity, 98% coverage: 9:392/392 of query aligns to 3:392/394 of 1e5eA
- active site: R55 (≠ L62), Y108 (= Y115), D181 (= D187), K206 (= K212)
- binding n-(hydroxy{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)norvaline: Y53 (= Y60), R55 (≠ L62), G83 (= G90), M84 (≠ L91), Y108 (= Y115), N155 (≠ S162), D181 (= D187), S203 (≠ A209), T205 (= T211), K206 (= K212), S335 (= S342), T350 (vs. gap), R370 (= R370)
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
32% identity, 85% coverage: 57:389/392 of query aligns to 48:385/390 of 8j6nA
- binding [6-methyl-4-[(~{E})-(oxamoylhydrazinylidene)methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate: Y51 (= Y60), R53 (≠ L62), G81 (= G90), L82 (= L91), Y105 (= Y115), E148 (= E158), N152 (≠ S162), D178 (= D187), S200 (≠ A209), T202 (= T211), K203 (= K212), E330 (≠ Y341), S331 (= S342), T346 (≠ K356), R366 (= R370)
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
31% identity, 97% coverage: 12:392/392 of query aligns to 4:373/373 of 4l0oH
- active site: R40 (≠ L62), Y92 (= Y115), D164 (= D187), K189 (= K212)
- binding pyridoxal-5'-phosphate: Y38 (= Y60), R40 (≠ L62), S67 (= S89), G68 (= G90), L69 (= L91), Y92 (= Y115), D164 (= D187), S186 (≠ A209), T188 (= T211), K189 (= K212)
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
30% identity, 99% coverage: 3:392/392 of query aligns to 2:384/385 of 5x5hA
- active site: R52 (≠ L62), Y105 (= Y115), D177 (= D187), K202 (= K212)
- binding magnesium ion: F36 (= F41), Q38 (≠ D43), E49 (≠ T59), E69 (= E79), Q187 (≠ K197), P188 (≠ A198), L189 (≠ F199)
- binding pyridoxal-5'-phosphate: G80 (= G90), M81 (≠ L91), Y105 (= Y115), D177 (= D187), S199 (≠ A209), T201 (= T211), K202 (= K212)
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
32% identity, 85% coverage: 57:390/392 of query aligns to 41:377/377 of 7d7oB
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
31% identity, 93% coverage: 27:392/392 of query aligns to 5:374/377 of 7ba4A
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
29% identity, 96% coverage: 13:389/392 of query aligns to 7:389/393 of 5x30C
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
29% identity, 96% coverage: 13:389/392 of query aligns to 12:394/398 of 1pg8A
- active site: R61 (≠ L62), Y114 (= Y115), D186 (= D187), K211 (= K212)
- binding pyridoxal-5'-phosphate: Y59 (= Y60), R61 (≠ L62), S88 (= S89), G89 (= G90), M90 (≠ L91), Y114 (= Y115), D186 (= D187), S208 (≠ A209), T210 (= T211), K211 (= K212)
Query Sequence
>HSERO_RS14995 FitnessBrowser__HerbieS:HSERO_RS14995
VSDPKQTSLTPQTSLVHSSYRAPDGFEAFPVGIHHASTVLFPDVAAMRSRDWREKLGYTY
GLHGTPTSFVLEARLAEIEGGKYCRVTPSGLAAIAMVNFAFLKSGDDVLLPDNVYGPSKD
LGQWLERDFQITARFYDPMIGEGLAELIRPTTRLVWTEAPGSVSMEVPDIPALCRAAHAK
GVLVAIDNTWSAGIAFKAFEHGVDIVMQAVTKYQSGGSDVLMGAVIVRDQALNEKLELAH
MRLGFGVGMDDVYMVLRSLSSMRLRFEAHDAAARKVAAWLKQRPEIVAVLHPAFEDCPGH
AHWKRDFSGAGGLFSVIFDPRYVEAQTDRFVDSLRLFKIGYSWGGAHSLCVPYRMKGMRR
AWMREGQLVRFNIGLESPEDLIADIEQALARL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory