Comparing HSERO_RS15200 FitnessBrowser__HerbieS:HSERO_RS15200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
56% identity, 96% coverage: 19:526/528 of query aligns to 9:499/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
50% identity, 96% coverage: 22:528/528 of query aligns to 30:541/554 of P30952
Sites not aligning to the query:
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 96% coverage: 21:525/528 of query aligns to 18:525/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 96% coverage: 21:525/528 of query aligns to 18:525/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
50% identity, 96% coverage: 21:525/528 of query aligns to 13:520/524 of 3cv2A
P37330 Malate synthase G; MSG; EC 2.3.3.9 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 78% coverage: 109:522/528 of query aligns to 263:699/723 of P37330
Sites not aligning to the query:
1d8cA Malate synthase g complexed with magnesium and glyoxylate (see paper)
23% identity, 71% coverage: 148:522/528 of query aligns to 317:686/709 of 1d8cA
Sites not aligning to the query:
1p7tA Structure of escherichia coli malate synthase g:pyruvate:acetyl- coenzyme a abortive ternary complex at 1.95 angstrom resolution (see paper)
23% identity, 71% coverage: 148:522/528 of query aligns to 314:683/706 of 1p7tA
Sites not aligning to the query:
>HSERO_RS15200 FitnessBrowser__HerbieS:HSERO_RS15200
MTQLKLPTGMEISGDIKPGYENILTFEALSLVAKLSRAFEGRRQELLAARAERVKRLDAG
ERPDFLKETESIRTGDWKIAPIPEALKCRRVEITGPVERKMVINAFNSGADSYMTDFEDS
NSPVWDNQISGQINLYDAIRRTISLESNGKSYKLNDKIATLVVRPRGWHLDEKHVTLDGK
RISGGIFDFALFLFHNAKEQLARGAGPYFYLPKMESHLEARLWNDIFVMAQNEIGLPQGT
IKATVLIETITAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKNDKDFCLADRAKVT
MTSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMQGIINDKRRDATDGY
DGGWVAHPGLVEASMKEFVAVLGDKPNQFEKQRPDVDVKAADLLNFQPETPITEAGLRYN
INVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRAQVWQWIRSAKGNLEDGRKVTADMVR
AMIPEELAKVKQVAGDGPTYDRAAKIFEEMSTSETFAEFLTLPLYEEI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory