SitesBLAST
Comparing HSERO_RS15435 FitnessBrowser__HerbieS:HSERO_RS15435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O69762 Hydroxycinnamoyl-CoA hydratase-lyase; HCHL; P-hydroxycinnamoyl CoA hydratase/lyase; Trans-feruloyl-CoA hydratase/vanillin synthase; EC 4.1.2.61 from Pseudomonas fluorescens (see 2 papers)
33% identity, 90% coverage: 13:253/269 of query aligns to 18:263/276 of O69762
- K29 (≠ I24) binding
- A68 (= A63) binding
- M70 (≠ A65) binding
- L72 (= L67) binding
- Y75 (≠ M70) binding
- G120 (= G113) binding
- S123 (≠ G116) mutation to A: Reduced kcat compared to wild-type but not markerdly.
- S142 (= S135) binding
- E143 (= E136) mutation to A: Abolishes catalytic activity.
- W146 (≠ L139) binding
- G151 (≠ A144) binding
- Y239 (= Y230) binding ; mutation to F: Increased KM for feruloyl-CoA but retains a significant amount of catalytic activity with a kcat 10 times less than that of the wild-type.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2vssB Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
34% identity, 75% coverage: 13:213/269 of query aligns to 15:218/247 of 2vssB
- active site: M67 (≠ A65), Y72 (≠ M70), D77 (= D75), R89 (≠ K87), Q93 (vs. gap), G117 (= G113), S120 (≠ G116), S139 (= S135), E140 (= E136), I145 (≠ L141), P147 (= P143), G148 (≠ A144)
- binding acetyl coenzyme *a: E25 (= E23), K26 (≠ I24), R27 (≠ H25), A29 (= A27), A65 (= A63), M67 (≠ A65), D68 (= D66), W113 (≠ A109), F115 (≠ M111), G117 (= G113), S139 (= S135), E140 (= E136)
Sites not aligning to the query:
2vssD Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
34% identity, 75% coverage: 13:213/269 of query aligns to 16:219/246 of 2vssD
- active site: M68 (≠ A65), Y73 (≠ M70), D78 (= D75), R90 (≠ K87), Q94 (vs. gap), G118 (= G113), S121 (≠ G116), S140 (= S135), E141 (= E136), I146 (≠ L141), P148 (= P143), G149 (≠ A144)
- binding acetyl coenzyme *a: E26 (= E23), K27 (≠ I24), R28 (≠ H25), A30 (= A27), A66 (= A63), M68 (≠ A65), D69 (= D66), L70 (= L67), F74 (≠ R71), W114 (≠ A109), F116 (≠ M111), S140 (= S135)
- binding 4-hydroxy-3-methoxybenzaldehyde: M68 (≠ A65), Y73 (≠ M70), F74 (≠ R71), Q96 (≠ L91), E141 (= E136), G149 (≠ A144), N150 (≠ A145)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
28% identity, 91% coverage: 14:259/269 of query aligns to 14:256/259 of 5zaiC
- active site: A65 (= A65), F70 (≠ M70), S82 (≠ A85), R86 (≠ A89), G110 (= G113), E113 (≠ G116), P132 (≠ S135), E133 (= E136), I138 (≠ L141), P140 (= P143), G141 (≠ A144), A226 (≠ E226), F236 (≠ A236)
- binding coenzyme a: K24 (≠ I24), L25 (≠ H25), A63 (= A63), G64 (= G64), A65 (= A65), D66 (= D66), I67 (≠ L67), P132 (≠ S135), R166 (= R168), F248 (= F251), K251 (= K254)
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
33% identity, 75% coverage: 13:213/269 of query aligns to 17:215/244 of 6l3pA
- active site: M69 (≠ A65), Y74 (≠ M70), R86 (= R83), Q90 (≠ K87), G114 (= G113), S117 (≠ G116), S136 (= S135), E137 (= E136), I142 (≠ L141), P144 (= P143), G145 (≠ A144)
- binding coenzyme a: K28 (≠ I24), R29 (≠ H25), A31 (= A27), A67 (= A63), M69 (≠ A65), D70 (= D66), L71 (= L67), G113 (= G112)
Sites not aligning to the query:
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
34% identity, 78% coverage: 13:221/269 of query aligns to 15:226/246 of 6p5uE
- active site: M67 (≠ A65), Y72 (≠ M70), D77 (= D75), R89 (≠ D84), A93 (= A89), G117 (= G113), T120 (≠ G116), E140 (= E136), I145 (≠ L141), P147 (= P143), A148 (= A144)
- binding coenzyme a: D25 (≠ E23), K26 (≠ I24), R27 (≠ H25), A29 (= A27), A65 (= A63), M67 (≠ A65), D68 (= D66), L69 (= L67), W113 (≠ A109), F115 (≠ M111), S139 (= S135), W143 (≠ L139)
Sites not aligning to the query:
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
31% identity, 75% coverage: 12:212/269 of query aligns to 16:208/260 of 2uzfA
- active site: G70 (≠ A65), R80 (≠ E79), L84 (≠ R83), G108 (= G113), V111 (≠ G116), T130 (≠ S135), G131 (≠ E136), S136 (≠ L141), D138 (≠ P143), A139 (= A144)
- binding acetoacetyl-coenzyme a: V28 (≠ I24), R29 (≠ H25), S68 (≠ A63), G69 (= G64), G70 (≠ A65), D71 (= D66), Y104 (≠ A109), G108 (= G113)
Sites not aligning to the query:
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 74% coverage: 13:212/269 of query aligns to 86:285/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
31% identity, 74% coverage: 13:212/269 of query aligns to 22:221/273 of Q5HH38
- R34 (≠ H25) binding in other chain
- SGGDQ 73:77 (≠ AGADL 63:67) binding in other chain
- S149 (≠ L141) binding in other chain
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
28% identity, 93% coverage: 13:261/269 of query aligns to 33:280/285 of 4i42A
- active site: G86 (≠ A65), R91 (= R71), Y97 (≠ S77), H105 (≠ A85), L109 (≠ A89), G133 (= G113), V136 (≠ G116), G156 (≠ E136), S161 (≠ L141), D163 (≠ P143), G164 (≠ A144), A250 (≠ T231), Y258 (≠ R239)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ I24), R45 (≠ H25), S84 (≠ A63), G85 (= G64), G86 (≠ A65), D87 (= D66), Q88 (≠ L67), K89 (≠ A68), Y97 (≠ S77), V108 (≠ L88), Y129 (≠ A109), G133 (= G113), T155 (≠ S135), S161 (≠ L141), T254 (≠ I235), F270 (= F251), K273 (= K254)
P0ABU0 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 93% coverage: 13:261/269 of query aligns to 33:280/285 of P0ABU0
- R45 (≠ H25) binding in other chain
- SGGDQK 84:89 (≠ AGADLA 63:68) binding in other chain
- K89 (≠ A68) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- R91 (= R71) mutation to A: Loss of DHNA-CoA synthase activity.
- Y97 (≠ S77) binding in other chain; mutation to F: Loss of DHNA-CoA synthase activity.
- YSIGG 129:133 (≠ AVMGG 109:113) binding in other chain
- Q154 (≠ L134) mutation to A: Reduces the specific DHNA-CoA synthase activity by 15-fold, whereas its affinity for hydrogencarbonate is reduced by 36-fold.
- QTG 154:156 (≠ LSE 134:136) binding
- T155 (≠ S135) binding in other chain
- G156 (≠ E136) mutation to D: Loss of DHNA-CoA synthase activity.
- S161 (≠ L141) binding in other chain
- W184 (≠ F163) mutation to F: Reduces the specific DHNA-CoA synthase activity by 530-fold, whereas its affinity for hydrogencarbonate is reduced by 20-fold.
- Y258 (≠ R239) binding
- R267 (≠ L248) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- F270 (= F251) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- K273 (= K254) binding ; mutation to A: Impairs protein folding.
3t88A Crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa (see paper)
28% identity, 93% coverage: 13:261/269 of query aligns to 29:276/281 of 3t88A
- active site: G82 (≠ A65), R87 (= R71), Y93 (≠ S77), H101 (≠ A85), L105 (≠ A89), G129 (= G113), V132 (≠ G116), G152 (≠ E136), S157 (≠ L141), D159 (≠ P143), G160 (≠ A144), A246 (≠ T231), Y254 (≠ R239)
- binding o-succinylbenzoyl-N-coenzyme A: Q39 (≠ E23), V40 (≠ I24), R41 (≠ H25), A43 (= A27), S80 (≠ A63), G81 (= G64), G82 (≠ A65), D83 (= D66), Q84 (≠ L67), K85 (≠ A68), Y93 (≠ S77), V104 (≠ L88), L105 (≠ A89), Y125 (≠ A109), G129 (= G113), T151 (≠ S135), V155 (≠ L139), F158 (≠ A142), D159 (≠ P143), T250 (≠ I235), Y254 (≠ R239), F266 (= F251), K269 (= K254)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
33% identity, 92% coverage: 14:260/269 of query aligns to 13:250/250 of 3q0gD
- active site: A64 (= A65), M69 (= M70), T75 (≠ R78), F79 (≠ L82), G103 (= G113), E106 (≠ G116), P125 (≠ S135), E126 (= E136), V131 (≠ L141), P133 (= P143), G134 (≠ A144), L219 (≠ S228), F229 (≠ R239)
- binding Butyryl Coenzyme A: F225 (≠ I235), F241 (= F251)
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
28% identity, 93% coverage: 13:261/269 of query aligns to 30:263/268 of 4elxA
- active site: G83 (≠ A65), H88 (≠ M70), L92 (≠ A74), G116 (= G113), V119 (≠ G116), G139 (≠ E136), S144 (≠ L141), D146 (≠ P143), G147 (≠ A144), A233 (≠ T231), Y241 (≠ R239)
- binding chloride ion: G115 (= G112), G139 (≠ E136), W167 (≠ F163)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
33% identity, 91% coverage: 17:262/269 of query aligns to 16:256/256 of 3h81A
- active site: A64 (= A65), M69 (= M70), T79 (≠ R78), F83 (≠ L82), G107 (= G113), E110 (≠ G116), P129 (≠ S135), E130 (= E136), V135 (≠ L141), P137 (= P143), G138 (≠ A144), L223 (≠ S228), F233 (≠ R239)
- binding calcium ion: F233 (≠ R239), Q238 (≠ G244)
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
28% identity, 93% coverage: 13:261/269 of query aligns to 33:280/285 of Q7CQ56
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
33% identity, 91% coverage: 17:260/269 of query aligns to 17:255/255 of 3q0jC
- active site: A65 (= A65), M70 (= M70), T80 (≠ R78), F84 (≠ L82), G108 (= G113), E111 (≠ G116), P130 (≠ S135), E131 (= E136), V136 (≠ L141), P138 (= P143), G139 (≠ A144), L224 (≠ S228), F234 (≠ R239)
- binding acetoacetyl-coenzyme a: Q23 (≠ E23), A24 (≠ I24), L25 (≠ H25), A27 (= A27), A63 (= A63), G64 (= G64), A65 (= A65), D66 (= D66), I67 (≠ L67), K68 (≠ A68), M70 (= M70), F84 (≠ L82), G107 (= G112), G108 (= G113), E111 (≠ G116), P130 (≠ S135), E131 (= E136), P138 (= P143), G139 (≠ A144), M140 (vs. gap)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
33% identity, 91% coverage: 17:260/269 of query aligns to 17:255/255 of 3q0gC
- active site: A65 (= A65), M70 (= M70), T80 (≠ R78), F84 (≠ L82), G108 (= G113), E111 (≠ G116), P130 (≠ S135), E131 (= E136), V136 (≠ L141), P138 (= P143), G139 (≠ A144), L224 (≠ S228), F234 (≠ R239)
- binding coenzyme a: L25 (≠ H25), A63 (= A63), I67 (≠ L67), K68 (≠ A68), Y104 (≠ A109), P130 (≠ S135), E131 (= E136), L134 (= L139)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
31% identity, 96% coverage: 1:259/269 of query aligns to 1:265/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
28% identity, 93% coverage: 13:261/269 of query aligns to 30:262/267 of 4elwA
- active site: G83 (≠ A65), L91 (≠ R83), G115 (= G113), V118 (≠ G116), G138 (≠ E136), S143 (≠ L141), D145 (≠ P143), G146 (≠ A144), A232 (≠ T231), Y240 (≠ R239)
- binding nitrate ion: G114 (= G112), T137 (≠ S135), G138 (≠ E136), F144 (≠ A142), W166 (≠ F163)
Query Sequence
>HSERO_RS15435 FitnessBrowser__HerbieS:HSERO_RS15435
MSSAAHLDITPRGLATITLNRPEIHNAFDDQLIAHLIDLLTQARDDTRTCLLLLASTGKS
FSAGADLAWMRRMADASREDNLRDARKLALLMETLNSFPTPTLAKVQGAVMGGGVGLVSC
CDIVVASDAAFFALSEVKLGLAPAAISPYVIAKMGVSQARRYFVSAERFPAARAAAMGLV
HEVAPPDELDARTAQLIDTLLANGPQAMRAAKQLVQVANPLQVTPELSEYTAGVIADLRA
SAEGREGLRAFLDKDAPAWTRQQPTSGAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory