Comparing HSERO_RS15500 FitnessBrowser__HerbieS:HSERO_RS15500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
26% identity, 98% coverage: 6:276/276 of query aligns to 5:280/281 of P94530
8hpsB ABC transporter, permease protein SugB (see paper)
25% identity, 87% coverage: 28:267/276 of query aligns to 20:263/264 of 8hpsB
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
29% identity, 76% coverage: 67:276/276 of query aligns to 78:295/296 of P68183
>HSERO_RS15500 FitnessBrowser__HerbieS:HSERO_RS15500
MIAPTSPFADRHRALETVSAWVLALLWLLPLLYALWTAFHPAAFATRFTLDAPLTLQNFV
NAWQAAPFPRYFLNTFLLVTMILAAQLVLATLAAYAFARFTFRGSNVMFMLVLLQLMVMP
DILIVENYQTMNLLGLRDTILSIGLPYFASAFGIFLLRQTFKTVPRELDEAATVEGASAW
QILMQVYVPLARPIYIAFGLVSVSTHWNNFLWPLIVTNSVESRPLTVGLQVFSSTDQGVD
WSIITAATLMTSAPLLLAFLLFQRQFVQSFMRAGIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory