Comparing HSERO_RS15640 FitnessBrowser__HerbieS:HSERO_RS15640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
41% identity, 96% coverage: 4:163/167 of query aligns to 3:162/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
41% identity, 96% coverage: 4:163/167 of query aligns to 2:161/173 of 5t7dA
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
44% identity, 97% coverage: 3:164/167 of query aligns to 4:168/181 of 5dwnA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
44% identity, 97% coverage: 4:165/167 of query aligns to 3:164/176 of 6m7gA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
44% identity, 97% coverage: 4:165/167 of query aligns to 3:164/179 of 5wphA
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
44% identity, 96% coverage: 1:160/167 of query aligns to 2:162/165 of 4jwpA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
39% identity, 97% coverage: 4:165/167 of query aligns to 4:166/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 97% coverage: 4:165/167 of query aligns to 2:164/171 of Q8ZPD3
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
39% identity, 98% coverage: 1:164/167 of query aligns to 1:166/172 of A6VCX3
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
38% identity, 99% coverage: 1:165/167 of query aligns to 1:167/185 of 4jxrB
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
39% identity, 96% coverage: 4:164/167 of query aligns to 3:165/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
39% identity, 96% coverage: 4:164/167 of query aligns to 2:164/170 of 2j8rA
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
33% identity, 96% coverage: 5:164/167 of query aligns to 5:165/165 of 4mbuA
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
35% identity, 87% coverage: 19:164/167 of query aligns to 25:172/180 of 2jlmF
>HSERO_RS15640 FitnessBrowser__HerbieS:HSERO_RS15640
MQPSIRPATAADAPALCGIYNHYVATTAISFETEPVSEESMVARIAEVQAKFPWLVYEEE
GQVLGYAYATQWKPRAAYRQSVESSVYLRHDAGGRGIGKRLYRQLFAELKPLGIHLVIGG
IAQPNAASVALHESLGFVKCGVFNEVGYKMGRWIDMGYWQLKLQEVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory