Comparing HSERO_RS15785 FitnessBrowser__HerbieS:HSERO_RS15785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
53% identity, 96% coverage: 6:300/306 of query aligns to 3:296/304 of 4ur8A
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
53% identity, 96% coverage: 6:300/306 of query aligns to 3:296/310 of 5hwnB
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 87% coverage: 40:304/306 of query aligns to 27:289/292 of Q07607
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
28% identity, 89% coverage: 22:292/306 of query aligns to 10:279/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
28% identity, 89% coverage: 22:292/306 of query aligns to 10:279/296 of 7lvlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
28% identity, 92% coverage: 22:301/306 of query aligns to 10:294/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
29% identity, 71% coverage: 22:238/306 of query aligns to 10:227/294 of 4i7wA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
28% identity, 93% coverage: 17:300/306 of query aligns to 12:290/297 of 5j5dA
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
28% identity, 93% coverage: 17:300/306 of query aligns to 11:289/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 93% coverage: 17:300/306 of query aligns to 15:293/300 of P9WP25
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
27% identity, 87% coverage: 22:288/306 of query aligns to 10:288/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
27% identity, 87% coverage: 22:288/306 of query aligns to 10:288/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
27% identity, 87% coverage: 22:288/306 of query aligns to 10:288/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
27% identity, 87% coverage: 22:288/306 of query aligns to 10:288/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
27% identity, 87% coverage: 22:288/306 of query aligns to 10:288/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
27% identity, 87% coverage: 22:288/306 of query aligns to 10:288/291 of 3pueB
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
27% identity, 75% coverage: 22:251/306 of query aligns to 10:238/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
27% identity, 75% coverage: 22:251/306 of query aligns to 10:238/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
27% identity, 75% coverage: 22:251/306 of query aligns to 11:239/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
26% identity, 75% coverage: 22:251/306 of query aligns to 10:238/292 of 3i7sA
Sites not aligning to the query:
>HSERO_RS15785 FitnessBrowser__HerbieS:HSERO_RS15785
MSQYTPQDLKQILSSGLLSFPLTDFDEQGDFRPKTYIERLEWLAPYGASALFAAGGTGEF
FSLVPGEYSDIIRTAVDTCRGKVPIIAGAGGSTRAAIAYAQEAERLGAHGILLMPHYLTE
ASQDGIAAHVEAVCKSVKFGVIIYNRAVCKLNADTLQKLADRCPNLIGFKDGIGEIEPMV
HIRRKLGDRFTYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAVEFYQAIAKEDHDT
VGKLIDEFFLPYLAIRNRKAGYAVSIVKAGARIAGHDAGPVRTPLTDCTPEEHEELAALM
NKLGPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory