Comparing HSERO_RS15940 FitnessBrowser__HerbieS:HSERO_RS15940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
45% identity, 97% coverage: 2:325/334 of query aligns to 1:321/611 of 8j5qD
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
45% identity, 97% coverage: 2:325/334 of query aligns to 1:321/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
45% identity, 97% coverage: 2:325/334 of query aligns to 1:321/608 of 8j5sD
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
38% identity, 91% coverage: 4:307/334 of query aligns to 3:312/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 92% coverage: 1:308/334 of query aligns to 1:307/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 92% coverage: 2:308/334 of query aligns to 1:296/310 of 4fwiB
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 72% coverage: 19:258/334 of query aligns to 13:239/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 76% coverage: 4:258/334 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 76% coverage: 4:258/334 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 76% coverage: 4:258/334 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 76% coverage: 4:258/334 of query aligns to 3:241/242 of 2oljA
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
32% identity, 69% coverage: 27:258/334 of query aligns to 22:247/250 of 7z18I
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 73% coverage: 11:255/334 of query aligns to 29:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 73% coverage: 11:255/334 of query aligns to 29:263/382 of 7aheC
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
32% identity, 69% coverage: 27:258/334 of query aligns to 22:247/253 of 7z15I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
32% identity, 69% coverage: 27:258/334 of query aligns to 22:247/250 of 7z16I
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
31% identity, 72% coverage: 11:252/334 of query aligns to 29:260/260 of 7ahdC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 70% coverage: 21:255/334 of query aligns to 18:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 70% coverage: 21:255/334 of query aligns to 19:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 70% coverage: 21:255/334 of query aligns to 19:242/344 of 3tuiC
Sites not aligning to the query:
>HSERO_RS15940 FitnessBrowser__HerbieS:HSERO_RS15940
MSVLLDVKNLKVDLPTENGMLHAVRGIDFQVRRGEMLCLVGESGCGKSMTSLALMGLLPR
KAQCSADHILFDGVDLHGMPDKQLMQLRGKRMAMIFQEPMTSLNPSYTLGNQLCEAMLQQ
PGVSRAEARERALYLLHRTGISNAEDRLRQYPHQLSGGLRQRVMIAMSLMCNPDLIIADE
PTTALDVTIQAQILRMIRELQQEFGAAVIFITHDLGVVSRIADRVAVMYAGQVVETTDVA
QLFAQPRHPYTQGLLNCIPVRGKTLPGSHLQAIPGVVPSLVGQVSGCAFRNRCAKADSGC
ERDPQMVQQGSVTAPHQARCLKLDVAMDAMEVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory