Comparing HSERO_RS16100 FitnessBrowser__HerbieS:HSERO_RS16100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8uw6B Acetylornithine deacetylase from escherichia coli, di-zinc form.
34% identity, 78% coverage: 64:376/400 of query aligns to 58:359/381 of 8uw6B
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
28% identity, 83% coverage: 64:394/400 of query aligns to 50:373/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
28% identity, 83% coverage: 64:394/400 of query aligns to 54:377/380 of 5vo3A
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
26% identity, 96% coverage: 15:396/400 of query aligns to 7:366/366 of Q8P8J5
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
29% identity, 83% coverage: 64:393/400 of query aligns to 50:376/377 of 7t1qA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 78% coverage: 81:393/400 of query aligns to 64:372/375 of 4pqaA
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
26% identity, 92% coverage: 15:383/400 of query aligns to 8:348/360 of 2f7vA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 78% coverage: 81:393/400 of query aligns to 64:372/376 of 4o23A
7uoiA Crystallographic structure of dape from enterococcus faecium (see paper)
26% identity, 95% coverage: 9:387/400 of query aligns to 3:374/383 of 7uoiA
7lgpB Dape enzyme from shigella flexneri
27% identity, 78% coverage: 81:393/400 of query aligns to 65:377/377 of 7lgpB
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 56% coverage: 68:291/400 of query aligns to 64:294/407 of P37111
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 32% coverage: 64:190/400 of query aligns to 52:181/258 of 4h2kA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
28% identity, 64% coverage: 68:324/400 of query aligns to 64:319/408 of Q03154
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
26% identity, 79% coverage: 70:383/400 of query aligns to 48:325/341 of 5xoyA
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
36% identity, 24% coverage: 65:159/400 of query aligns to 114:210/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
36% identity, 24% coverage: 65:159/400 of query aligns to 83:179/471 of 3dljA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
23% identity, 83% coverage: 64:393/400 of query aligns to 85:418/426 of 3pfoA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
38% identity, 28% coverage: 80:190/400 of query aligns to 63:179/265 of 4op4B
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
35% identity, 24% coverage: 65:159/400 of query aligns to 85:181/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
35% identity, 24% coverage: 65:159/400 of query aligns to 85:181/478 of 2zofA
Sites not aligning to the query:
>HSERO_RS16100 FitnessBrowser__HerbieS:HSERO_RS16100
MNASLTTAASQPTRQTLDILTTLIGFNTVSRESNLGLIEWVRDHLERHGAVTRLTYDAER
RKANLFATLGDAGPGRFGTVFSGHTDVVPVTGQKWDTDPFVAHVADGKLFGRGACDMKGF
IAICMARLPAIDLARLHTPLHFSFSYDEEVGCLGVRELLADLQQNDIRPTGVIIGEPTMM
QPVIAHKGKRSYRCSVHGHAAHSSCPHLGINSIDFAAMMQLKIREIALRVRHSGVQDDDF
DVPYSSIATTLTSGGNAPNIIPDKAEFVFEHRFLPGIDPAEVFEEVKAYAEQEILPQMRI
DGVQGRIEFETLTSYPGMCTPADDPLVTSALRILGSERARKVGFGTEGGLFGQAGMPAVI
CGPGDIAHAHKPNEFVTLEQLARCERFFDNFIASAHLQPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory