Comparing HSERO_RS16440 FitnessBrowser__HerbieS:HSERO_RS16440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kb1C Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
36% identity, 99% coverage: 3:411/413 of query aligns to 1:423/428 of 7kb1C
7kb1A Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
36% identity, 99% coverage: 3:411/413 of query aligns to 1:423/428 of 7kb1A
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
36% identity, 99% coverage: 3:411/413 of query aligns to 1:391/395 of 5m3zA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
36% identity, 99% coverage: 2:411/413 of query aligns to 1:392/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
36% identity, 99% coverage: 2:411/413 of query aligns to 1:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
36% identity, 99% coverage: 2:411/413 of query aligns to 1:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
36% identity, 99% coverage: 2:411/413 of query aligns to 1:392/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
36% identity, 99% coverage: 2:411/413 of query aligns to 1:392/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
36% identity, 99% coverage: 2:411/413 of query aligns to 1:392/396 of 4hf8A
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
36% identity, 99% coverage: 5:412/413 of query aligns to 4:395/399 of 5dx5A
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
35% identity, 99% coverage: 2:411/413 of query aligns to 1:381/386 of 3mkjA
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
36% identity, 99% coverage: 5:413/413 of query aligns to 1:391/393 of 5x30C
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
36% identity, 99% coverage: 4:413/413 of query aligns to 4:395/397 of 3vk3A
O13326 Homocysteine synthase; O-acetylhomoserine sulfhydrylase; OAH SHL; OAH sulfhydrylase; EC 2.5.1.49 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 98% coverage: 9:412/413 of query aligns to 8:427/429 of O13326
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
36% identity, 99% coverage: 4:413/413 of query aligns to 5:396/398 of 1pg8A
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
36% identity, 99% coverage: 4:413/413 of query aligns to 5:396/398 of P13254
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
36% identity, 98% coverage: 8:413/413 of query aligns to 3:390/392 of 5x2xA
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
36% identity, 98% coverage: 8:413/413 of query aligns to 3:390/392 of 5x2wA
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
37% identity, 99% coverage: 3:411/413 of query aligns to 1:371/377 of 7ba4A
2ctzA Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
35% identity, 98% coverage: 9:411/413 of query aligns to 3:420/421 of 2ctzA
>HSERO_RS16440 FitnessBrowser__HerbieS:HSERO_RS16440
MNDKKTYGFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGR
QGNPTVAALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNTNSLW
MTVGAQGAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGIL
YVVDNTMTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDWTRYPHIAENY
KKNPAPQWGMAQIRAKALRDFGGSLGPEAAHHIAVGAETIALRQERECKNALALAQMLQA
DERVAAVYYPGLESHPQHALSKALFRSFGSLMSFELKDGIDCFDYLNRLRLAIPTSNLGD
TRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDDLVADFRQALDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory