Comparing HSERO_RS16670 HSERO_RS16670 acetylornithine aminotransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
43% identity, 97% coverage: 11:398/400 of query aligns to 11:393/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
43% identity, 97% coverage: 11:398/400 of query aligns to 3:385/385 of Q9X2A5
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
43% identity, 96% coverage: 11:395/400 of query aligns to 4:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
43% identity, 96% coverage: 11:395/400 of query aligns to 3:375/375 of 2eh6A
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
43% identity, 93% coverage: 25:397/400 of query aligns to 26:401/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
45% identity, 90% coverage: 25:384/400 of query aligns to 26:384/400 of 4addA
Sites not aligning to the query:
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
40% identity, 95% coverage: 17:395/400 of query aligns to 10:385/388 of 3nx3A
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 95% coverage: 19:398/400 of query aligns to 25:403/405 of P40732
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
38% identity, 95% coverage: 19:398/400 of query aligns to 20:398/402 of 4jevB
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 99% coverage: 5:398/400 of query aligns to 63:456/457 of Q9M8M7
Sites not aligning to the query:
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
37% identity, 95% coverage: 19:398/400 of query aligns to 20:393/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
37% identity, 95% coverage: 19:398/400 of query aligns to 14:387/389 of 2pb0A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
35% identity, 95% coverage: 18:396/400 of query aligns to 17:390/390 of 8ht4B
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
37% identity, 96% coverage: 14:396/400 of query aligns to 23:395/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
37% identity, 96% coverage: 14:396/400 of query aligns to 15:387/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
37% identity, 96% coverage: 14:396/400 of query aligns to 15:387/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
37% identity, 96% coverage: 14:396/400 of query aligns to 15:387/387 of 1vefA
Sites not aligning to the query:
Q6LFH8 Ornithine aminotransferase; PfOAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 from Plasmodium falciparum (isolate 3D7) (see paper)
35% identity, 93% coverage: 20:391/400 of query aligns to 30:403/414 of Q6LFH8
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
36% identity, 95% coverage: 18:395/400 of query aligns to 18:383/390 of A0QYS9
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 95% coverage: 18:397/400 of query aligns to 26:395/400 of P9WPZ7
Sites not aligning to the query:
>HSERO_RS16670 HSERO_RS16670 acetylornithine aminotransferase
MQYSQSDANKLMYVTNRPELVFTEGHGMWLTDHNGKRYLDYLQGWAVNTLGHAPQCIADA
LAAQSKKLINPSPAFYNEPSIELAKLLTANSVFDRVFFANSGGEANEGAIKLARKWGKKN
PAADGSARFEIITFKHSFHGRTLATMSASGKDGWDTMFAPQVPGFPKAVLNDLESVKALI
GEHTVAVMLEPVQGEGGVIPASKEFMQGLRSLTKEKNLLLIVDEVQSGMGRTGQLFAYQH
SGIEPDIMTLAKGIGGGVPLAALLAREEIACFEAGEQGGTYNGNPLMTAVGVAVIKELLK
PGFMESVRERGQYLRQRSLEISEKYGFEGERGEGLLRALQLGRDIGPQIVEAARNLEPVG
LLLNSPRPNLLRFMPALNVTKEEIDQMFSMLEEVLAKIGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory