Comparing HSERO_RS16725 FitnessBrowser__HerbieS:HSERO_RS16725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
31% identity, 86% coverage: 15:270/299 of query aligns to 34:288/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
33% identity, 73% coverage: 53:271/299 of query aligns to 245:477/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
33% identity, 73% coverage: 53:271/299 of query aligns to 260:492/514 of P02916
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 94% coverage: 7:288/299 of query aligns to 4:278/285 of 7cagA
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
37% identity, 41% coverage: 116:239/299 of query aligns to 132:238/296 of P68183
>HSERO_RS16725 FitnessBrowser__HerbieS:HSERO_RS16725
MLSRFLNNRNVLGMLFMAPAVILLVVFLTYPLGLGIWLGFTDTKIGGEGSFIGLDNFTYL
AGDSLAQLSLFNTVFYTVSASILKFMLGLWLAILLNKNVPLKTFFRAIVLLPWIVPTALS
ALAFWWLYDAQFSVISWALHKMGLIDRYIDFLGDPWNARWSTVFANVWRGIPFVAISLLA
GLQTISPSLYEAAAIDGATPWQQFRHVTLPLLTPIIAVVMTFSVLFTFTDFQLIYVLTRG
GPLNATHLMATLSFQRAIPGGALGEGAALATYMIPFLLAAIMFSYFGLQRRGWQQGGDK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory