Comparing HSERO_RS16740 FitnessBrowser__HerbieS:HSERO_RS16740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
22% identity, 96% coverage: 8:579/593 of query aligns to 3:532/537 of 7w2jD
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
22% identity, 96% coverage: 8:579/593 of query aligns to 6:535/540 of 8jejA
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
22% identity, 82% coverage: 98:582/593 of query aligns to 90:530/531 of 8grjB
Sites not aligning to the query:
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
28% identity, 23% coverage: 448:582/593 of query aligns to 324:452/458 of 7qfdA
Sites not aligning to the query:
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
28% identity, 23% coverage: 448:582/593 of query aligns to 358:486/494 of 7qf8A
Sites not aligning to the query:
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
28% identity, 23% coverage: 448:582/593 of query aligns to 323:451/457 of 7qvaA
Sites not aligning to the query:
>HSERO_RS16740 FitnessBrowser__HerbieS:HSERO_RS16740
MAIKKDKVDVVMVGLGWTGSIMGMELTEAGLSVLALERGDMRDTNTDTPYPKAVDELKYS
VRGALFQDLSRETVTIRHTLSDVAVPYRQHGSFLLGDGVGGAGFHWNGMMYRNLPEELEM
RTHHEQKYGKKFIPEDMTIQDHGVTYKELEPFYDFSEKVMAVSGKAGNLKGQIVPGGNPL
EGERSDEFPTPPLQYQYSASLVEKAMRDVGYHPYPAPAANASQPFTNPYGVRIGPCNYCG
FCENYGCYMYSKASPQTTILPVLLKRKNFEVRTKAQVIKVNLDASGKRATGVTYIDAQGR
EVEQPADLVLLTAFQTHNVRLLLLSGIGKPYDPVTGEGVVGKNFAYQYNGGINVIMPKGT
QFNPFIGTGAGGVGMDDLNADQFDHGPLGFIGGASIRHVRYGGRPIKQAGTMPGEKVPSW
GSEWKASVQDAYQRTLTIGMSGSVMAYRDCYLSLDPTYRDANGQPLLRLTLNWKENEGKM
LTYIASQMEKVGQAMNPEKVVKAVRKTGSSWDTRVYQSTHLTGGAIMGTTPKNSVVNKYL
QSWDVPNVFVYGACAFPQNMGYNPTGLVTALAYHSAKAIREQYLKNPGPLVQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory