Comparing HSERO_RS16785 FitnessBrowser__HerbieS:HSERO_RS16785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
50% identity, 93% coverage: 11:323/335 of query aligns to 5:317/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
46% identity, 91% coverage: 11:316/335 of query aligns to 5:278/287 of 3v0sA
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 92% coverage: 19:327/335 of query aligns to 9:325/333 of O14295
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
33% identity, 92% coverage: 11:318/335 of query aligns to 4:311/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
33% identity, 91% coverage: 11:315/335 of query aligns to 5:309/310 of P46336
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
37% identity, 91% coverage: 10:315/335 of query aligns to 4:292/301 of 6ow0B
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
33% identity, 88% coverage: 19:312/335 of query aligns to 25:286/286 of 8hnqA
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
37% identity, 91% coverage: 10:315/335 of query aligns to 4:316/323 of 6ow0A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
33% identity, 91% coverage: 12:315/335 of query aligns to 6:310/331 of P80874
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
32% identity, 91% coverage: 10:314/335 of query aligns to 4:273/274 of 5danA
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
32% identity, 91% coverage: 10:314/335 of query aligns to 5:274/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
32% identity, 91% coverage: 10:314/335 of query aligns to 5:274/275 of 6kikA
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
33% identity, 91% coverage: 12:315/335 of query aligns to 6:310/333 of 1pz1A
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 88% coverage: 12:307/335 of query aligns to 6:313/326 of P77256
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 90% coverage: 12:312/335 of query aligns to 12:339/351 of Q9P7U2
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 90% coverage: 10:312/335 of query aligns to 14:318/335 of 4aubB
Sites not aligning to the query:
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
36% identity, 62% coverage: 10:218/335 of query aligns to 5:206/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
36% identity, 62% coverage: 10:218/335 of query aligns to 5:206/298 of 1ynpB
Sites not aligning to the query:
8hw0A The structure of akr6d1
31% identity, 94% coverage: 10:325/335 of query aligns to 4:329/329 of 8hw0A
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
31% identity, 91% coverage: 10:315/335 of query aligns to 15:308/312 of 3erpA
>HSERO_RS16785 FitnessBrowser__HerbieS:HSERO_RS16785
LQAHSPVGTRRLGSNGPLVSAIGLGCMGMSDFYAQRDDAESLATIDRALELGINLLDTAD
MYGPYTNEELLGRAIKGRRDKFFIATKFGIRRDPSDPGARGVDGSPAYIRQAVEGSLKRL
GVETIDLYYQHRIDPATPIEVTMGVLADLVQAGKIRYIGLSEASAATLERAHRVHPVTAL
QSEYSLWTRDPEAEVLAACRTLGIGFVAYSPLGRGFLTGAIQRFEDLAEDDFRRSNPRFQ
GENFARNLQLAEKVKEMAGQHGCTPSQLALAWVMAQDPHIVPIPGTKRRRYLEDNAGSVG
VKLAPEDLQALDAIFPRGAAAGERYTDASMKMLNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory