Comparing HSERO_RS16820 FitnessBrowser__HerbieS:HSERO_RS16820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 71% coverage: 59:389/465 of query aligns to 32:381/446 of A0A0H2VG78
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 32% coverage: 93:239/465 of query aligns to 90:221/582 of O23492
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 35% coverage: 93:255/465 of query aligns to 105:252/514 of Q9LT15
Sites not aligning to the query:
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
32% identity, 35% coverage: 93:255/465 of query aligns to 85:232/487 of 7aaqA
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 31% coverage: 95:238/465 of query aligns to 93:221/580 of Q9C757
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
31% identity, 35% coverage: 93:255/465 of query aligns to 90:237/485 of 7aarA
Sites not aligning to the query:
8fvzA Pipt y150a
23% identity, 93% coverage: 27:457/465 of query aligns to 2:432/433 of 8fvzA
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
29% identity, 32% coverage: 62:211/465 of query aligns to 49:189/496 of P11169
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
29% identity, 32% coverage: 62:211/465 of query aligns to 46:186/468 of 7spsA
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
29% identity, 32% coverage: 62:211/465 of query aligns to 49:189/470 of 4zw9A
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 68% coverage: 75:389/465 of query aligns to 55:349/403 of P77589
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
29% identity, 32% coverage: 62:211/465 of query aligns to 47:187/469 of 7crzA
Sites not aligning to the query:
5c65A Structure of the human glucose transporter glut3 / slc2a3
29% identity, 32% coverage: 62:211/465 of query aligns to 45:185/457 of 5c65A
Sites not aligning to the query:
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
29% identity, 32% coverage: 62:211/465 of query aligns to 49:189/470 of 7sptA
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
24% identity, 36% coverage: 85:251/465 of query aligns to 66:245/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
24% identity, 36% coverage: 85:251/465 of query aligns to 66:245/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
24% identity, 36% coverage: 85:251/465 of query aligns to 66:245/475 of 4gbyA
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 36% coverage: 85:251/465 of query aligns to 70:249/491 of P0AGF4
Sites not aligning to the query:
>HSERO_RS16820 FitnessBrowser__HerbieS:HSERO_RS16820
VRPTQEISMSDTTQASTPLSAAEYRKRIFAILGASSGNLVEWFDFYVYSFCAIYFAPAFF
PKGDPTSQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRKTSMLISVLMMCGGSLAVAVM
PTYATIGAWAPALLLLARLFQGLSVGGEYGTSATYMSEVAPNGRRGFFASFQYVTLIGGQ
LLAVLVLFGMQQWLTKAELMAWGWRVPFVLGAVGALVAMYLRSSLAETSSAGARKKKDAG
TLKGLLQHKRAFLNVVGFTAGGSLMFYTFTTYMQKYLVNTAGMDPKVANGVMTGALFVYM
ILQPIFGAISDKIGRRNSMLCFAFFGMVGTFPILHFLKDVSSPGVAMALAILALTIVSFY
TSISGLIKAEMFPPEVRALGVGLSYAVGNAIFGGSAEFVALSLKSAGIESAFYWYVSALC
LVALIISLRMPDPQRDGHLKGDVAMNPDEHQGEADAAAGKLHKPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory