SitesBLAST
Comparing HSERO_RS17235 FitnessBrowser__HerbieS:HSERO_RS17235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 97% coverage: 5:257/261 of query aligns to 5:242/244 of 4nbuB
- active site: G18 (= G18), N111 (= N115), S139 (= S143), Q149 (≠ R153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ T97), K98 (≠ E102), S139 (= S143), N146 (≠ F150), V147 (≠ A151), Q149 (≠ R153), Y152 (= Y156), F184 (≠ I188), M189 (≠ R193), K200 (≠ R215)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A14), N17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ V39), V59 (≠ T61), D60 (= D62), V61 (= V63), N87 (= N90), A88 (= A91), G89 (= G92), I90 (= I93), T137 (≠ I141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ I188), T185 (≠ V189), T187 (≠ G191), M189 (≠ R193)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 97% coverage: 3:255/261 of query aligns to 1:243/247 of 4jroC
- active site: G16 (= G18), S142 (= S143), Q152 (≠ R153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (≠ A14), S14 (≠ A16), R15 (≠ Q17), G16 (= G18), I17 (= I19), N35 (≠ C37), Y36 (≠ D38), N37 (≠ V39), G38 (≠ S40), S39 (≠ E41), N63 (≠ D62), V64 (= V63), N90 (= N90), A91 (= A91), I93 (= I93), I113 (≠ V114), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (≠ G191)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
33% identity, 96% coverage: 5:255/261 of query aligns to 3:243/248 of 4urfB
- active site: G16 (= G18), S142 (= S143), I152 (≠ R153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L222), R211 (= R223), R212 (≠ K224)
- binding bicarbonate ion: I92 (= I93), G94 (= G95), R109 (≠ Q110), R179 (= R180), S228 (= S240)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), G14 (≠ A16), N15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ V39), D62 (= D62), T63 (≠ V63), N89 (= N90), A90 (= A91), G91 (= G92), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), I188 (≠ V189), T190 (≠ G191)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
33% identity, 96% coverage: 5:255/261 of query aligns to 3:243/248 of 4urfA
- active site: G16 (= G18), S142 (= S143), I152 (≠ R153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I93), S93 (≠ A94), G94 (= G95), E95 (≠ P96), T97 (≠ S98), E101 (= E102), T103 (≠ A104), Q106 (≠ D107), R109 (≠ Q110), S175 (≠ P176), G177 (≠ H178)
- binding magnesium ion: S237 (≠ Q249), Y238 (≠ S250)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), G14 (≠ A16), N15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ V39), W41 (≠ F43), D62 (= D62), T63 (≠ V63), N89 (= N90), A90 (= A91), G91 (= G92), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (≠ G191)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
33% identity, 96% coverage: 5:255/261 of query aligns to 3:243/248 of 4ureB
- active site: G16 (= G18), S142 (= S143), I152 (≠ R153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ Q17), G16 (= G18), I17 (= I19), N89 (= N90), G91 (= G92), Y155 (= Y156), P185 (= P186), A186 (≠ G187)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 93% coverage: 7:248/261 of query aligns to 4:236/248 of 6ixmC
- active site: G16 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), S15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ V39), A61 (≠ T61), D62 (= D62), T63 (≠ V63), N89 (= N90), A90 (= A91), M140 (≠ I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), Y187 (≠ I188), I188 (≠ V189), L192 (≠ R193)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 98% coverage: 1:255/261 of query aligns to 1:250/255 of 5itvA
- active site: G18 (= G18), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A14), S17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ V39), T61 (= T61), I63 (≠ V63), N89 (= N90), G91 (= G92), T139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I186 (= I188), I187 (≠ V189)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
36% identity, 98% coverage: 3:259/261 of query aligns to 3:257/258 of 3ak4A
- active site: G18 (= G18), S141 (= S143), L151 (≠ R153), Y154 (= Y156), K158 (= K160), E199 (≠ K201)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), L39 (≠ V39), V60 (≠ T61), D61 (= D62), V62 (= V63), N88 (= N90), A89 (= A91), G90 (= G92), T139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), G185 (= G187), V187 (= V189), T189 (≠ G191), M191 (≠ R193)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
35% identity, 96% coverage: 5:255/261 of query aligns to 2:250/255 of 2q2qD
- active site: G15 (= G18), S138 (= S143), Y151 (= Y156), K155 (= K160), R196 (≠ K201)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A14), T13 (≠ A16), S14 (≠ Q17), G15 (= G18), I16 (= I19), F36 (≠ V39), D59 (= D62), L60 (≠ V63), N86 (= N90), G88 (= G92), L109 (≠ V114), I136 (= I141), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), W183 (≠ I188), V184 (= V189), T186 (≠ G191), L188 (≠ R193), V189 (≠ Q194)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 96% coverage: 8:257/261 of query aligns to 6:236/240 of 2d1yA
- active site: G16 (= G18), S135 (= S143), N145 (≠ R153), Y148 (= Y156), K152 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A14), R15 (≠ Q17), I17 (= I19), D36 (= D38), L37 (≠ V39), R38 (≠ S40), V55 (≠ T61), D56 (= D62), L57 (≠ V63), N83 (= N90), A84 (= A91), A85 (≠ G92), I86 (= I93), V133 (≠ I141), S135 (= S143), Y148 (= Y156), K152 (= K160), P178 (= P186), G179 (= G187), I181 (≠ V189), T183 (≠ Q194), A185 (≠ R196), V186 (≠ I197)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 97% coverage: 3:255/261 of query aligns to 1:241/248 of Q9KJF1
- M1 (≠ L3) modified: Initiator methionine, Removed
- S15 (≠ Q17) binding
- D36 (= D38) binding
- D62 (= D62) binding
- I63 (≠ V63) binding
- N89 (= N90) binding
- Y153 (= Y156) binding
- K157 (= K160) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 96% coverage: 5:255/261 of query aligns to 2:240/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A14), M16 (≠ I19), D35 (= D38), I36 (≠ V39), I62 (≠ V63), N88 (= N90), G90 (= G92), I138 (= I141), S140 (= S143), Y152 (= Y156), K156 (= K160), I185 (≠ V189)
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
35% identity, 97% coverage: 6:257/261 of query aligns to 2:256/259 of 1w4zA
- active site: G15 (= G18), N112 (= N115), S142 (= S143), Y155 (= Y156), K159 (= K160), Y200 (≠ K201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (≠ A14), T13 (≠ A16), S14 (≠ Q17), G15 (= G18), I16 (= I19), R36 (≠ V39), G37 (≠ S40), D61 (= D62), V62 (= V63), N88 (= N90), G90 (= G92), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), V188 (= V189), T190 (≠ G191)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
35% identity, 97% coverage: 6:257/261 of query aligns to 4:258/261 of P16544
- 11:39 (vs. 12:40, 34% identical) binding
- D63 (= D62) binding
- K161 (= K160) binding
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
35% identity, 97% coverage: 6:257/261 of query aligns to 11:265/268 of 2rh4B
- active site: G24 (= G18), N121 (= N115), S151 (= S143), Y164 (= Y156), K168 (= K160), Y209 (≠ K201)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (≠ A14), T22 (≠ A16), S23 (≠ Q17), I25 (= I19), A44 (≠ D38), R45 (≠ V39), G46 (≠ S40), C69 (vs. gap), D70 (= D62), V71 (= V63), N97 (= N90), S151 (= S143), Y164 (= Y156), K168 (= K160), G195 (= G187), V197 (= V189), T199 (≠ G191), M201 (≠ R193)
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
35% identity, 95% coverage: 11:257/261 of query aligns to 5:253/256 of 1xr3A
- active site: G12 (= G18), N109 (= N115), S139 (= S143), Y152 (= Y156), K156 (= K160), Y197 (≠ K201)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ V144), G141 (≠ A145), V146 (≠ F150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (≠ A14), T10 (≠ A16), S11 (≠ Q17), G12 (= G18), I13 (= I19), A32 (≠ D38), R33 (≠ V39), G34 (≠ S40), C57 (vs. gap), D58 (= D62), V59 (= V63), N85 (= N90), A86 (= A91), G87 (= G92), S139 (= S143), Y152 (= Y156), K156 (= K160), G183 (= G187), V185 (= V189), T187 (≠ G191), P188 (≠ A192)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
35% identity, 95% coverage: 11:257/261 of query aligns to 6:254/257 of 2rh4A
- active site: G13 (= G18), N110 (= N115), S140 (= S143), Y153 (= Y156), K157 (= K160), Y198 (≠ K201)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ V144), Q145 (≠ L148), V147 (≠ F150), Y153 (= Y156), F185 (≠ I188), L254 (≠ V257)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (≠ A14), T11 (≠ A16), S12 (≠ Q17), G13 (= G18), I14 (= I19), A33 (≠ D38), R34 (≠ V39), G35 (≠ S40), C58 (vs. gap), D59 (= D62), V60 (= V63), N86 (= N90), G88 (= G92), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), G184 (= G187), V186 (= V189), T188 (≠ G191), M190 (≠ R193)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
36% identity, 98% coverage: 4:260/261 of query aligns to 4:254/254 of 4fn4A
- active site: G18 (= G18), S144 (= S143), Y157 (= Y156), K161 (= K160), S202 (≠ E210)
- binding nicotinamide-adenine-dinucleotide: G14 (≠ A14), S17 (≠ Q17), G18 (= G18), I19 (= I19), E38 (≠ D38), L39 (≠ V39), R43 (≠ F43), A63 (≠ T61), D64 (= D62), V65 (= V63), N91 (= N90), G93 (= G92), I94 (= I93), T142 (≠ I141), S144 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), V190 (= V189), T192 (≠ A203), N193 (≠ A204), I194 (≠ Y205)
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
36% identity, 96% coverage: 8:257/261 of query aligns to 1:252/255 of 3sjuA
- active site: G11 (= G18), S138 (= S143), Y151 (= Y156), K155 (= K160), Y196 (≠ K201)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (≠ A14), S10 (≠ Q17), A31 (vs. gap), R32 (vs. gap), D33 (= D38), C56 (≠ T61), D57 (= D62), V58 (= V63), S84 (≠ N90), A85 (= A91), G86 (= G92), I136 (= I141), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), Y183 (≠ I188), V184 (= V189), T186 (≠ G191), M188 (≠ R193)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
37% identity, 98% coverage: 3:257/261 of query aligns to 1:237/240 of 4dmmB
- active site: G16 (= G18), S142 (= S143), Q152 (≠ R153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (≠ A14), S14 (≠ A16), R15 (≠ Q17), G16 (= G18), I17 (= I19), A37 (≠ V39), S38 (= S40), S39 (≠ E41), A62 (≠ T61), D63 (= D62), V64 (= V63), N90 (= N90), A91 (= A91), L113 (≠ V114), I140 (= I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), G186 (= G187), I188 (≠ V189), T190 (≠ E210), M192 (= M212)
Query Sequence
>HSERO_RS17235 FitnessBrowser__HerbieS:HSERO_RS17235
MDLNLKDQKVIVTAGAQGIGLAITAAFVEAGAHVHICDVSEDFLASARARFGHAPVSYSR
TDVSSEREVDAMFADLAQRWSGRLDVLINNAGIAGPTSPVEEVALSDWDQTLAVNLTGPF
LCTRRAVPLLKKNGGGAIVNISSVAGRLGFALRTPYSASKYGVIGLTETWAIELGPSHIR
VNAVLPGIVEGARQERIVAAKAAAYGIGHEEMRQRLLSRVSLRKMVTAEDIANQVIFLCS
PAGASISGQSLSVCGNVEVLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory