Comparing HSERO_RS17550 FitnessBrowser__HerbieS:HSERO_RS17550 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
66% identity, 88% coverage: 28:246/249 of query aligns to 5:225/226 of 8eyzA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
45% identity, 87% coverage: 27:243/249 of query aligns to 5:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
45% identity, 87% coverage: 27:243/249 of query aligns to 5:226/226 of 4zv1A
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 90% coverage: 23:246/249 of query aligns to 2:228/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 90% coverage: 23:246/249 of query aligns to 8:234/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
38% identity, 88% coverage: 28:246/249 of query aligns to 3:224/231 of 2q2cA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
40% identity, 87% coverage: 27:242/249 of query aligns to 11:228/229 of 5t0wA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
38% identity, 88% coverage: 24:242/249 of query aligns to 12:234/235 of 4g4pA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 86% coverage: 28:242/249 of query aligns to 12:227/229 of 6svfA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
37% identity, 78% coverage: 49:242/249 of query aligns to 19:210/217 of 2pyyB
Sites not aligning to the query:
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
35% identity, 87% coverage: 27:242/249 of query aligns to 2:222/224 of 4ymxA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
33% identity, 90% coverage: 21:245/249 of query aligns to 1:229/230 of 4kqpA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
35% identity, 89% coverage: 22:242/249 of query aligns to 1:226/234 of 3k4uE
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
34% identity, 90% coverage: 17:240/249 of query aligns to 2:233/240 of 4h5fA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
39% identity, 79% coverage: 49:245/249 of query aligns to 38:237/243 of 5eyfB
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
34% identity, 87% coverage: 22:237/249 of query aligns to 12:231/239 of 4zefA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
31% identity, 86% coverage: 27:241/249 of query aligns to 1:219/223 of 8b5dA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
28% identity, 88% coverage: 26:245/249 of query aligns to 13:242/246 of 4ohnA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
31% identity, 94% coverage: 8:242/249 of query aligns to 6:253/260 of P02911
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
31% identity, 86% coverage: 27:241/249 of query aligns to 4:222/226 of 6fxgB
>HSERO_RS17550 FitnessBrowser__HerbieS:HSERO_RS17550
MKLPFAKLVFASLVALSVVGASARAETLVVACDTAFVPFEFKDRNQYVGFDIDLWDAIAK
DIGVTYKLQPMDFNGIIPALQTKNVDVALAGITIKDERKKVIDFSDGYYDSGFSLMVPVG
SSIKSVADLAGKALAVKSGTSAFDYAKANFKATELHQFPNIDNAYLELQTGRVDAAMHDT
PNVLYYIATAGKGRAKVVGTQMMAHQYGIGFPKGSPLVPKVNAALAKIKADGRYAEIYRK
WFGAEPPKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory