Comparing HSERO_RS17575 FitnessBrowser__HerbieS:HSERO_RS17575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
53% identity, 90% coverage: 31:305/305 of query aligns to 4:278/278 of 2ia4B
2vhaA Debp (see paper)
53% identity, 90% coverage: 31:304/305 of query aligns to 3:276/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
53% identity, 81% coverage: 31:277/305 of query aligns to 1:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 75% coverage: 45:273/305 of query aligns to 6:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 75% coverage: 45:273/305 of query aligns to 6:223/225 of 4zv2A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
32% identity, 78% coverage: 36:273/305 of query aligns to 6:234/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 78% coverage: 35:273/305 of query aligns to 2:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 78% coverage: 36:274/305 of query aligns to 3:228/229 of 6svfA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
26% identity, 83% coverage: 28:279/305 of query aligns to 41:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
26% identity, 83% coverage: 28:279/305 of query aligns to 40:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
26% identity, 83% coverage: 28:279/305 of query aligns to 40:281/287 of 6h1uA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
23% identity, 81% coverage: 33:280/305 of query aligns to 3:246/246 of 4ohnA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
25% identity, 75% coverage: 35:264/305 of query aligns to 7:236/324 of 4z9nB
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 78% coverage: 35:271/305 of query aligns to 3:229/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
24% identity, 75% coverage: 44:273/305 of query aligns to 2:222/224 of 4ymxA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
23% identity, 79% coverage: 36:277/305 of query aligns to 1:235/237 of 4i62A
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
24% identity, 76% coverage: 45:277/305 of query aligns to 3:232/235 of 5owfA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
24% identity, 76% coverage: 45:277/305 of query aligns to 28:257/260 of P02911
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
25% identity, 75% coverage: 45:273/305 of query aligns to 3:220/231 of 2q2cA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
24% identity, 78% coverage: 35:273/305 of query aligns to 5:230/237 of 3vv5A
>HSERO_RS17575 FitnessBrowser__HerbieS:HSERO_RS17575
MKCLVNLAVPAAMLSMMLAVLPQQACAADSALGPTLQKIKDANLIAIGHRTSSIPFSYYD
ENQQVIGYSQDLCNKVIDAVKTKIGAAKLEVRMVPVTSQNRTPLLQNGTIDLECGVTSNL
KSRWQQVSFATNFFVASSRILTKRDSGIKDFPDLAGKAVVTNAGTTSEQLLRNLNEHRKM
GMQIQSAKDYGEAFLILQSGRVAAYVMDDVLLAGARTTAQKPNDWVLTGNPFGAEPYAFM
VRRDDPQFKQLVDDTLSGLMKSGEIKKIYAKWFTFPIPPKNVSFNFPMSDTVMKLYATPS
DKPMD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory