Comparing HSERO_RS17580 FitnessBrowser__HerbieS:HSERO_RS17580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 95% coverage: 17:436/440 of query aligns to 35:444/448 of 6io1B
Sites not aligning to the query:
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 97% coverage: 10:436/440 of query aligns to 22:444/447 of 5lhaA
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 97% coverage: 10:436/440 of query aligns to 24:446/449 of 5lh9D
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 97% coverage: 14:438/440 of query aligns to 70:491/504 of Q94CE5
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 99% coverage: 3:437/440 of query aligns to 16:455/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 93% coverage: 19:428/440 of query aligns to 36:442/455 of 5kr5A
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
34% identity, 99% coverage: 2:438/440 of query aligns to 14:451/453 of 6s54A
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
35% identity, 93% coverage: 20:429/440 of query aligns to 34:438/459 of D6R3B6
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
37% identity, 95% coverage: 19:435/440 of query aligns to 32:442/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
37% identity, 95% coverage: 19:435/440 of query aligns to 32:442/451 of 6g4eA
Sites not aligning to the query:
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
37% identity, 95% coverage: 19:435/440 of query aligns to 32:442/453 of 6g4dB
Sites not aligning to the query:
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
33% identity, 95% coverage: 18:435/440 of query aligns to 32:440/448 of 3du4A
Sites not aligning to the query:
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
33% identity, 95% coverage: 18:435/440 of query aligns to 32:440/448 of P53555
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
32% identity, 95% coverage: 19:435/440 of query aligns to 34:433/438 of 6zhkA
Sites not aligning to the query:
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 95% coverage: 19:435/440 of query aligns to 33:435/443 of 6fyqA
Sites not aligning to the query:
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 98% coverage: 6:435/440 of query aligns to 24:450/458 of 5kr3A
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
33% identity, 100% coverage: 3:440/440 of query aligns to 16:458/458 of 3gjuA
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 97% coverage: 2:428/440 of query aligns to 20:444/459 of 5kquC
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
34% identity, 93% coverage: 19:428/440 of query aligns to 6:403/423 of 4a6rA
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
34% identity, 93% coverage: 19:428/440 of query aligns to 7:407/427 of 4ba5A
>HSERO_RS17580 FitnessBrowser__HerbieS:HSERO_RS17580
MTHVFHRNPRSKLPMAVAGEGMELIDQDGKRYIDASGGAAVSCLGHGHPRVIEAIRKQVG
ELAYAHTSFFTTAPAEELAAMLADAAPGSLNHVYFLSGGSEAVEAALKLARQYYVEVGQP
QRRHIIARRQSYHGNTLGALAIGGNAWRREMFMPMLIEAHHVSPCYAYRNRADGESDVQY
VQRLADELEQKILSLGADQVIAFVAETVVGATAGAVPPVGDYFRKIRAVCDKYGVLLILD
EVMSGMGRTGYLFACEEDGVVPDIVVIAKGLGAGYQPIGAMICSDHIYDAVLRGSGFFQH
GHTYIGHATACAAAVAVQKTIQEERLLENVRQRGEQLRSELRQAFGDQAHVGDIRGRGLF
VGVELVAERSSKLPLSPDLRTHARVKAEAMKRGLLVYPMGGTIDGKNGDHILLAPPFIAS
SNDISEIVQRLSDAVAASVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory