SitesBLAST
Comparing HSERO_RS17850 FitnessBrowser__HerbieS:HSERO_RS17850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
48% identity, 89% coverage: 6:267/294 of query aligns to 16:265/308 of P27305
- E55 (= E45) binding
- Y182 (= Y184) binding
- R200 (= R202) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
47% identity, 89% coverage: 6:267/294 of query aligns to 4:251/290 of 4a91A
- active site: S11 (= S13), K229 (= K243)
- binding glutamic acid: R7 (= R9), A9 (= A11), S11 (= S13), E43 (= E45), Y170 (= Y184), R188 (= R202), L192 (= L206)
- binding zinc ion: C99 (= C99), C101 (= C101), Y113 (= Y121), C117 (= C125)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
36% identity, 82% coverage: 9:250/294 of query aligns to 6:247/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
35% identity, 82% coverage: 9:250/294 of query aligns to 6:247/471 of P04805
- C98 (= C99) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C101) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C125) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (= H127) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ L129) mutation to Q: No change in activity or in zinc content.
- H131 (≠ P131) mutation to Q: No change in activity or in zinc content.
- H132 (≠ G132) mutation to Q: No change in activity or in zinc content.
- C138 (≠ L138) mutation to S: No change in activity or in zinc content.
- S239 (= S242) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
35% identity, 82% coverage: 9:250/294 of query aligns to 5:257/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
35% identity, 82% coverage: 9:250/294 of query aligns to 6:258/485 of Q8DLI5
- R6 (= R9) binding
- Y192 (= Y184) binding
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
36% identity, 82% coverage: 9:250/294 of query aligns to 6:232/380 of 4g6zA
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of 1g59A
- binding : D44 (= D48), R45 (≠ E49), A46 (≠ T50), R47 (= R51), P109 (≠ G100), V145 (≠ T137), R163 (≠ L159), V166 (≠ A163), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), D182 (= D179), E207 (≠ A204), E208 (≠ D205), R237 (≠ M234), K241 (≠ G238), T242 (≠ E239), K243 (= K240)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of 2cv2A
- active site: K246 (= K243)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R9), A7 (= A11), S9 (= S13), G17 (= G21), I21 (≠ A25), E41 (= E45), Y187 (= Y184), R205 (= R202), A206 (≠ G203), E208 (≠ D205), W209 (≠ L206), L235 (= L232), L236 (= L233)
- binding : S9 (= S13), T43 (≠ I47), D44 (= D48), R47 (= R51), V145 (≠ T137), R163 (≠ L159), Y168 (≠ H165), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), Y187 (= Y184), E207 (≠ A204), E208 (≠ D205), W209 (≠ L206), V211 (≠ D208), R237 (≠ M234), K241 (≠ G238)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of 2cv1A
- active site: K246 (= K243)
- binding adenosine-5'-triphosphate: P8 (= P12), S9 (= S13), G17 (= G21), T18 (≠ S22), I21 (≠ A25), R47 (= R51), A206 (≠ G203), W209 (≠ L206), L235 (= L232), L236 (= L233)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R9), A7 (= A11), E41 (= E45), Y187 (= Y184), R205 (= R202), W209 (≠ L206)
- binding : S9 (= S13), E41 (= E45), T43 (≠ I47), D44 (= D48), R47 (= R51), V145 (≠ T137), R163 (≠ L159), V166 (≠ A163), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), Y187 (= Y184), E207 (≠ A204), E208 (≠ D205), W209 (≠ L206), V211 (≠ D208), R237 (≠ M234), K241 (≠ G238), K243 (= K240)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of 1n78A
- active site: K246 (= K243)
- binding glutamol-amp: R5 (= R9), A7 (= A11), P8 (= P12), S9 (= S13), G17 (= G21), T18 (≠ S22), I21 (≠ A25), E41 (= E45), Y187 (= Y184), N191 (≠ V188), R205 (= R202), A206 (≠ G203), E208 (≠ D205), W209 (≠ L206), L235 (= L232), L236 (= L233)
- binding : S9 (= S13), T43 (≠ I47), D44 (= D48), R47 (= R51), V145 (≠ T137), R163 (≠ L159), V166 (≠ A163), Y168 (≠ H165), E172 (= E169), V177 (= V174), K180 (≠ R177), S181 (≠ A178), Y187 (= Y184), E207 (≠ A204), E208 (≠ D205), W209 (≠ L206), L210 (= L207), V211 (≠ D208), R237 (≠ M234), K241 (≠ G238)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of 1j09A
- active site: K246 (= K243)
- binding adenosine-5'-triphosphate: H15 (= H19), E208 (≠ D205), L235 (= L232), L236 (= L233), K243 (= K240), I244 (≠ F241), S245 (= S242), K246 (= K243), R247 (≠ Q244)
- binding glutamic acid: R5 (= R9), A7 (= A11), S9 (= S13), E41 (= E45), Y187 (= Y184), N191 (≠ V188), R205 (= R202), W209 (≠ L206)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 83% coverage: 7:251/294 of query aligns to 3:254/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
31% identity, 82% coverage: 9:250/294 of query aligns to 5:260/485 of 4griB
- active site: S9 (= S13), K253 (= K243)
- binding glutamic acid: R5 (= R9), A7 (= A11), S9 (= S13), E41 (= E45), Y194 (= Y184), R212 (= R202), W216 (≠ L206)
- binding zinc ion: C105 (= C99), C107 (= C101), Y128 (≠ T124), C132 (vs. gap)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
29% identity, 83% coverage: 9:251/294 of query aligns to 106:343/564 of 3al0C
- active site: S110 (= S13), K335 (= K243)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R9), A108 (= A11), P109 (= P12), G118 (= G21), T122 (≠ A25), E142 (= E45), Y276 (= Y184), R294 (= R202), G295 (= G203), D297 (= D205), H298 (≠ L206), L324 (= L232), I325 (≠ L233), L333 (≠ F241)
- binding : T144 (≠ I47), D145 (= D48), R148 (= R51), Y208 (= Y97), P213 (≠ S102), K252 (≠ L159), M255 (≠ A163), I266 (≠ V174), K269 (≠ R177), S270 (≠ A178), Y276 (= Y184), D297 (= D205), H298 (≠ L206), L299 (= L207), S300 (≠ D208), N301 (≠ S209), K304 (≠ R212), R330 (≠ G238), P332 (≠ K240)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
31% identity, 86% coverage: 9:262/294 of query aligns to 7:273/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
27% identity, 97% coverage: 9:292/294 of query aligns to 6:306/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 76% coverage: 7:229/294 of query aligns to 12:228/455 of 3aiiA
Sites not aligning to the query:
Query Sequence
>HSERO_RS17850 FitnessBrowser__HerbieS:HSERO_RS17850
VSCHAYVGRFAPSPSGPLHAGSLVAALASYLDARVHAGRWLLRIEDIDETRTVQGAAQDI
IATLAALDMRSDGPVLVQSQRKARYQLARDRLGALAYPCGCSRKEIADSRVGTASDGAAL
YPGTCRHGLAPGKQARTLRLRVPDPGQAGELVQFEDRWLGPQAQHLAAEVGDFVLQRADG
FWAYQLAVVVDDAEQGVTDIVRGADLLDSTARQIYLQGLLGYPTPRYLHVPLLMNETGEK
FSKQNGAQALDLNQPLQALQQAAAFLGLDTGAARDREGFWALALTGWQARFGPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory