SitesBLAST – Find functional sites

 

SitesBLAST

Comparing HSERO_RS17860 FitnessBrowser__HerbieS:HSERO_RS17860 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 19 hits to proteins with known functional sites (download)

6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
59% identity, 99% coverage: 3:226/227 of query aligns to 4:230/233 of 6j5yA

query
sites
6j5yA
F
 
F
A
 
A
I
 
P
P
 
E
A
 
A
P
 
P
A
 
V
Q
 
S
A
 
L
T
 
T
V
 
I
A
 
H
V
 
G
V
 
-
G
 
S
G
 
D
A
 
Q
A
 
T
F
 
F
P
 
P
V
 
V
R
 
R
R
 
R
I
 
V
Y
 
Y
C
 
C
V
 
V
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
A
H
|
H
A
 
A
R
 
R
E
 
E
M
 
M
G
 
G
H
 
F
D
 
D
P
 
P
D
 
E
R
 
R
E
 
E
P
 
P
P
 
P
F
 
F
F
 
F
F
|
F
M
 
C
K
 
K
P
 
P
A
 
A
D
 
D
A
 
A
V
 
V
V
 
V
P
 
P
T
 
V
D
 
A
S
 
A
-
 
G
-
 
S
-
 
T
-
 
L
V
 
E
V
 
L
P
 
A
Y
 
Y
P
 
P
V
 
S
A
 
Q
T
 
T
S
 
G
D
 
N
Y
 
Y
H
 
H
H
 
Y
E
|
E
I
 
I
E
|
E
L
 
L
V
 
V
V
 
A
A
 
A
L
 
I
A
 
G
K
 
K
G
 
G
G
 
G
R
 
C
N
 
D
I
 
I
P
 
P
V
 
L
E
 
E
Q
 
Q
A
 
A
L
 
E
E
 
E
L
 
H
V
 
V
F
 
W
G
 
G
Y
 
Y
A
 
A
V
 
V
G
 
G
L
 
L
D
|
D
M
 
M
T
 
T
R
 
R
R
 
R
D
 
D
I
 
L
Q
 
Q
S
 
M
Q
 
R
A
 
M
K
 
R
K
 
E
L
 
M
G
 
G
R
 
R
P
 
P
W
 
W
D
 
E
M
 
I
A
 
G
K
|
K
G
 
A
F
 
F
D
 
D
Q
 
R
S
 
S
A
 
A
P
 
P
C
 
I
A
 
G
P
 
P
I
 
L
V
 
Y
P
 
P
V
 
A
A
 
S
Q
 
Q
A
 
V
G
 
G
H
 
H
P
 
P
D
 
R
Q
 
H
G
 
A
A
 
A
V
 
I
W
 
S
L
 
L
K
 
Q
V
 
V
N
 
D
G
 
G
E
 
E
V
 
D
R
 
R
Q
 
Q
Q
 
R
G
 
S
D
 
D
L
 
I
A
 
D
D
 
Q
L
 
L
I
 
I
W
 
W
S
 
S
V
 
V
A
 
A
E
 
E
T
 
T
I
 
V
S
 
S
Y
 
Y
L
 
L
S
 
S
G
 
R
L
 
F
V
 
F
E
 
E
L
 
L
F
 
R
P
 
P
G
 
G
D
 
D
L
 
L
I
 
V
F
 
F
T
 
T
G
 
G
T
|
T
P
 
P
E
 
E
G
 
G
V
 
V
G
 
G
A
 
A
V
 
V
V
 
E
K
 
R
G
 
G
D
 
E
K
 
R
L
 
M
Q
 
L
G
 
G
H
 
A
V
 
I
D
 
D
G
 
G
L
 
L
P
 
G
D
 
E
I
 
L
N
 
S
I
 
V
T
 
R
I
 
V

6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
43% identity, 89% coverage: 24:226/227 of query aligns to 12:213/216 of 6sbiA

query
sites
6sbiA
R
 
K
R
 
N
I
 
I
Y
 
V
C
 
C
V
 
V
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
R
 
K
E
 
E
M
 
M
G
 
R
H
 
S
D
 
T
P
 
V
D
 
L
R
 
S
E
 
E
P
 
P
P
 
-
F
 
V
F
 
L
F
 
F
M
 
L
K
 
K
P
 
P
A
x
S
D
 
T
A
 
A
V
 
Y
V
 
A
P
 
P
T
 
E
D
 
G
S
 
S
V
 
P
V
 
V
P
 
L
Y
 
M
P
 
P
V
 
A
A
 
Y
T
 
C
S
 
R
D
 
N
Y
 
L
H
 
H
H
 
H
E
|
E
I
 
V
E
|
E
L
 
L
V
 
G
V
 
V
A
 
L
L
 
L
A
 
G
K
 
K
G
 
R
G
 
G
R
 
E
N
 
A
I
 
I
P
 
P
V
 
E
E
 
A
Q
 
A
A
 
A
L
 
M
E
 
D
L
 
Y
V
 
V
F
 
A
G
 
G
Y
 
Y
A
 
A
V
 
L
G
 
C
L
 
L
D
|
D
M
 
M
T
 
T
R
 
A
R
 
R
D
 
D
I
 
V
Q
 
Q
S
 
E
Q
 
E
A
 
C
K
 
K
K
 
K
L
 
K
G
 
G
R
 
L
P
 
P
W
 
W
D
 
T
M
 
L
A
 
A
K
|
K
G
 
S
F
 
F
D
 
T
Q
 
S
S
 
S
A
 
C
P
 
P
C
 
V
A
 
S
P
 
A
I
 
F
V
 
V
P
 
P
V
 
K
A
 
E
Q
 
K
A
 
I
G
 
P
H
 
D
P
 
P
D
 
H
Q
 
A
G
 
L
A
 
R
V
 
L
W
 
W
L
 
L
K
 
K
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
E
G
 
G
D
 
K
L
 
T
A
 
S
D
 
S
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
A
 
P
E
 
Y
T
 
I
I
 
I
S
 
S
Y
 
Y
L
 
V
S
 
S
G
 
K
L
 
I
V
 
I
E
x
T
L
 
L
F
 
E
P
 
E
G
 
G
D
 
D
L
 
L
I
 
I
F
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
K
G
 
G
V
|
V
G
 
G
A
 
P
V
 
I
V
 
K
K
 
E
G
 
N
D
 
D
K
 
E
L
 
I
Q
 
E
G
 
A
H
 
G
V
 
I
D
 
D
G
 
G
L
 
V
P
 
V
D
 
S
I
 
M
N
 
R
I
 
F
T
 
K
I
 
V

6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
43% identity, 89% coverage: 24:226/227 of query aligns to 13:214/218 of 6fogA

query
sites
6fogA
R
x
K
R
x
N
I
 
I
Y
 
V
C
 
C
V
 
V
G
|
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
 
H
A
 
V
R
 
R
E
 
E
M
 
M
G
 
R
H
 
S
D
 
A
P
 
V
D
 
L
R
 
S
E
 
E
P
 
P
P
 
-
F
 
V
F
 
L
F
 
F
M
 
L
K
 
K
P
 
P
A
 
S
D
 
T
A
 
A
V
 
Y
V
 
A
P
 
P
T
 
E
D
 
G
S
 
S
V
 
P
V
 
I
P
 
L
Y
 
M
P
 
P
V
 
A
A
 
Y
T
 
T
S
 
R
D
 
N
Y
 
L
H
 
H
H
 
H
E
|
E
I
 
L
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
L
 
M
A
 
G
K
 
K
G
 
R
G
 
C
R
 
R
N
 
A
I
 
V
P
 
P
V
 
E
E
 
A
Q
 
A
A
 
A
L
 
M
E
 
D
L
 
Y
V
 
V
F
 
G
G
 
G
Y
 
Y
A
 
A
V
 
L
G
 
C
L
 
L
D
|
D
M
 
M
T
 
T
R
 
A
R
 
R
D
 
D
I
 
V
Q
 
Q
S
 
D
Q
 
E
A
 
C
K
 
K
K
 
K
L
 
K
G
 
G
R
 
L
P
 
P
W
 
W
D
 
T
M
 
L
A
 
A
K
 
K
G
 
S
F
 
F
D
 
T
Q
 
A
S
 
S
A
 
C
P
 
P
C
 
V
A
 
S
P
 
A
I
 
F
V
 
V
P
 
P
V
 
K
A
 
E
Q
 
K
A
 
I
G
 
P
H
 
D
P
 
P
D
 
H
Q
 
K
G
 
L
A
 
K
V
 
L
W
 
W
L
 
L
K
 
K
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
E
G
 
G
D
 
E
L
 
T
A
 
S
D
 
S
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
A
 
P
E
 
Y
T
 
I
I
 
I
S
 
S
Y
 
Y
L
 
V
S
 
S
G
 
K
L
 
I
V
 
I
E
 
T
L
 
L
F
 
E
P
 
E
G
 
G
D
 
D
L
 
I
I
 
I
F
 
L
T
 
T
G
 
G
T
|
T
P
 
P
E
 
K
G
 
G
V
 
V
G
 
G
A
 
P
V
 
V
V
 
K
K
 
E
G
 
N
D
 
D
K
 
E
L
 
I
Q
 
E
G
 
A
H
 
G
V
 
I
D
 
H
G
 
G
L
 
L
P
 
V
D
 
S
I
 
M
N
 
T
I
 
F
T
 
K
I
 
V

Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
43% identity, 89% coverage: 24:226/227 of query aligns to 15:216/221 of Q6P587

query
sites
Q6P587
R
 
K
R
 
N
I
 
I
Y
 
V
C
 
C
V
 
V
G
 
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
R
 
R
E
|
E
M
 
M
G
 
R
H
 
S
D
 
A
P
 
V
D
 
L
R
 
S
E
 
E
P
 
P
P
 
-
F
 
V
F
 
L
F
 
F
M
 
L
K
 
K
P
 
P
A
 
S
D
 
T
A
 
A
V
 
Y
V
 
A
P
 
P
T
 
E
D
 
G
S
 
S
V
 
P
V
 
I
P
 
L
Y
 
M
P
 
P
V
 
A
A
 
Y
T
 
T
S
 
R
D
 
N
Y
 
L
H
 
H
H
 
H
E
|
E
I
 
L
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
L
 
M
A
 
G
K
 
K
G
 
R
G
 
C
R
 
R
N
 
A
I
 
V
P
 
P
V
 
E
E
 
A
Q
 
A
A
 
A
L
 
M
E
 
D
L
 
Y
V
 
V
F
 
G
G
 
G
Y
 
Y
A
 
A
V
 
L
G
 
C
L
 
L
D
|
D
M
 
M
T
 
T
R
 
A
R
|
R
D
 
D
I
 
V
Q
 
Q
S
 
D
Q
 
E
A
 
C
K
 
K
K
 
K
L
 
K
G
 
G
R
 
L
P
 
P
W
 
W
D
 
T
M
 
L
A
 
A
K
 
K
G
 
S
F
 
F
D
 
T
Q
 
A
S
 
S
A
 
C
P
 
P
C
 
V
A
 
S
P
 
A
I
 
F
V
 
V
P
 
P
V
 
K
A
 
E
Q
 
K
A
 
I
G
 
P
H
 
D
P
 
P
D
 
H
Q
 
K
G
 
L
A
 
K
V
 
L
W
 
W
L
 
L
K
 
K
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
E
G
 
G
D
 
E
L
 
T
A
 
S
D
 
S
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
A
 
P
E
 
Y
T
 
I
I
 
I
S
 
S
Y
 
Y
L
 
V
S
 
S
G
 
K
L
 
I
V
 
I
E
 
T
L
 
L
F
 
E
P
 
E
G
 
G
D
 
D
L
 
I
I
 
I
F
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
K
G
 
G
V
 
V
G
 
G
A
 
P
V
 
V
V
 
K
K
 
E
G
 
N
D
 
D
K
 
E
L
 
I
Q
 
E
G
 
A
H
 
G
V
 
I
D
 
H
G
 
G
L
 
L
P
 
V
D
 
S
I
 
M
N
 
T
I
 
F
T
 
K
I
 
V

3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
39% identity, 85% coverage: 25:216/227 of query aligns to 17:209/224 of 3v77A

query
sites
3v77A
R
 
K
I
 
I
Y
 
V
C
 
C
V
 
V
G
 
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
A
H
 
H
A
 
A
R
 
K
E
 
E
M
 
L
G
 
-
H
 
N
D
 
N
P
 
P
D
 
I
R
 
P
E
 
S
P
 
S
P
 
P
F
 
I
F
 
L
F
 
F
M
 
I
K
 
K
P
 
P
A
 
A
D
 
S
A
 
S
V
 
A
V
 
V
P
 
P
T
 
F
D
 
G
S
 
P
V
 
V
V
 
F
P
 
S
Y
 
I
P
 
P
V
 
K
A
 
D
T
 
Q
S
 
G
D
 
S
Y
 
V
H
 
H
H
 
H
E
 
E
I
 
L
E
|
E
L
 
I
V
 
A
V
 
I
A
 
L
L
 
I
A
 
G
K
 
K
G
 
A
G
 
L
R
 
S
N
 
R
I
 
A
P
 
S
V
 
T
E
 
E
Q
 
Q
A
 
V
L
 
A
E
 
E
L
 
S
V
 
I
F
 
A
G
 
G
Y
 
I
A
 
G
V
 
L
G
 
G
L
 
L
D
|
D
M
 
L
T
 
T
R
 
L
R
 
R
D
 
D
I
 
V
Q
 
Q
S
 
D
Q
 
Q
A
 
L
K
 
K
K
 
E
L
 
K
G
 
G
R
 
H
P
 
P
W
 
W
D
 
E
M
 
R
A
 
A
K
 
K
G
 
S
F
 
F
D
 
D
Q
 
G
S
 
A
A
 
C
P
 
P
C
 
L
A
 
T
P
 
E
I
 
F
V
 
V
P
 
A
V
 
V
A
 
N
Q
 
L
A
 
A
G
 
S
H
 
E
P
 
D
D
 
E
Q
 
W
G
 
Q
A
 
A
V
 
I
W
 
G
L
 
L
K
 
T
V
 
L
-
 
E
-
 
K
N
 
N
G
 
G
E
 
Q
V
 
F
R
 
Q
Q
 
Q
Q
 
Q
G
 
G
D
 
S
L
 
S
A
 
A
D
 
E
L
 
M
I
 
L
W
 
F
S
 
P
V
 
I
A
 
L
E
 
P
T
 
L
I
 
I
S
 
A
Y
x
H
L
 
M
S
 
S
G
 
E
L
x
H
V
 
F
E
 
S
L
 
L
F
 
Q
P
 
P
G
 
G
D
 
D
L
 
V
I
 
I
F
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
V
 
V
G
 
G
A
 
P
V
 
L
V
 
E
K
 
V
G
 
G
D
 
D
K
 
S
L
 
L
Q
 
S
G
 
A
H
 
K
V
 
L

1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
33% identity, 89% coverage: 24:224/227 of query aligns to 9:234/247 of 1nkqA

query
sites
1nkqA
R
 
R
R
 
K
I
 
I
Y
 
I
C
 
C
V
 
I
G
 
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
A
H
 
H
A
 
I
R
 
K
E
 
E
M
 
L
G
 
N
H
 
N
D
 
Q
P
 
P
D
 
-
R
 
-
E
 
-
P
 
-
P
 
-
F
 
F
F
 
F
F
 
F
M
 
L
K
 
K
P
 
P
A
 
T
D
 
S
A
 
S
V
 
I
V
 
V
P
 
T
-
 
P
-
 
L
-
 
S
-
 
S
-
 
S
-
 
P
-
 
A
-
 
N
-
 
S
-
 
T
-
 
F
-
 
N
-
 
G
-
 
L
-
 
N
T
 
E
D
 
D
S
 
G
V
 
T
V
 
N
P
 
P
Y
 
G
P
 
P
V
 
I
A
 
F
T
 
I
S
 
P
-
 
R
-
 
G
-
 
V
D
 
K
Y
 
V
H
 
H
H
 
H
E
|
E
I
 
I
E
|
E
L
 
L
V
 
A
V
 
L
A
 
I
L
 
V
A
 
S
K
 
K
G
 
H
G
 
L
R
 
S
N
 
N
I
 
V
P
 
T
V
 
K
-
 
M
-
 
K
-
 
P
E
 
E
Q
 
E
A
 
V
L
 
Y
E
 
D
L
 
S
V
 
I
F
 
S
G
 
G
Y
 
V
A
 
A
V
 
L
G
 
A
L
 
L
D
|
D
M
 
L
T
 
T
R
 
A
R
 
R
D
 
N
I
 
V
Q
 
Q
S
 
D
Q
 
E
A
 
A
K
 
K
K
 
K
L
 
K
G
 
G
R
 
L
P
 
P
W
 
W
D
 
T
M
 
I
A
 
S
K
 
K
G
 
G
F
 
F
D
 
D
Q
 
T
S
 
F
A
 
M
P
 
P
C
 
I
A
 
S
P
 
A
I
 
I
V
 
V
P
 
S
V
 
R
A
 
E
-
 
K
-
 
F
-
 
S
-
 
S
-
 
Y
Q
 
K
A
 
S
G
 
N
H
 
L
P
 
Q
D
 
D
Q
 
I
G
 
F
A
 
R
V
 
V
W
 
K
L
 
C
K
 
S
V
 
V
N
 
N
G
 
G
E
 
Q
V
 
L
R
 
R
Q
 
Q
Q
 
D
G
 
G
D
 
G
L
 
T
A
 
N
D
 
L
L
 
M
I
 
L
W
 
H
S
 
P
V
 
L
A
 
H
E
 
K
T
 
I
I
 
L
S
 
Q
Y
 
H
L
 
I
S
 
S
G
 
T
L
 
M
V
 
I
E
 
S
L
 
L
F
 
E
P
 
P
G
 
G
D
 
D
L
 
I
I
 
I
F
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
V
 
V
G
 
G
A
 
E
V
 
L
V
 
K
K
 
P
G
 
G
D
 
D
K
 
R
L
 
V
Q
 
H
G
 
C
H
 
E
V
 
L
-
 
L
-
 
Q
-
 
N
-
 
N
D
 
D
G
 
N
L
 
I
P
 
V
D
 
D
I
 
M
N
 
N
I
 
F

6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
37% identity, 95% coverage: 4:219/227 of query aligns to 51:268/279 of 6v77B

query
sites
6v77B
A
 
A
I
 
L
P
 
P
A
 
A
P
 
P
A
 
S
Q
 
-
A
 
A
T
 
R
V
 
V
A
 
G
V
 
T
V
 
I
G
 
G
G
 
S
A
 
P
A
 
A
F
 
P
P
 
L
V
 
P
R
 
R
R
 
Q
I
 
V
Y
 
F
C
 
A
V
 
V
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
D
A
 
D
H
 
H
A
 
A
R
 
T
E
 
E
M
 
S
G
 
G
H
 
L
D
 
S
P
 
-
D
 
K
R
 
P
E
 
E
P
 
H
P
 
P
F
 
V
F
 
I
F
 
F
M
 
T
K
 
K
P
 
F
A
 
V
D
 
S
A
 
S
V
 
I
V
 
T
P
 
G
T
 
P
D
 
V
S
 
E
V
 
T
V
 
V
P
 
Q
Y
 
L
P
 
P
V
 
A
A
 
G
T
 
S
S
 
V
D
 
D
Y
 
W
H
 
-
H
 
-
E
|
E
I
 
V
E
|
E
L
 
L
V
 
V
V
 
V
A
 
V
L
 
M
A
 
G
K
 
R
G
 
G
G
 
G
R
 
R
N
 
N
I
 
I
P
 
P
V
 
E
E
 
D
Q
 
R
A
 
A
L
 
W
E
 
E
L
 
F
V
 
V
F
 
A
G
 
G
Y
 
V
A
 
S
V
 
V
G
 
G
L
 
Q
D
|
D
M
 
L
T
 
S
R
 
E
R
 
R
D
 
D
I
 
L
Q
 
Q
S
 
-
Q
 
-
A
 
-
K
 
-
K
 
-
L
 
L
G
 
A
R
 
G
P
 
P
-
 
A
-
 
P
-
 
Q
W
 
F
D
 
S
M
 
L
A
 
A
K
 
K
G
 
S
F
 
H
D
 
A
Q
 
G
S
 
F
A
 
S
P
 
P
C
 
I
A
 
G
P
 
P
-
 
E
I
 
L
V
 
V
P
 
T
V
 
V
A
 
D
Q
 
E
A
 
L
G
 
P
H
 
D
P
 
P
D
 
D
Q
 
D
G
 
L
A
 
E
V
 
L
W
 
G
L
 
A
K
 
E
V
 
I
N
 
N
G
 
G
E
 
E
V
 
T
R
 
V
Q
 
Q
Q
 
H
G
 
S
D
 
R
L
 
T
A
 
S
D
 
Q
L
 
L
I
 
I
W
 
F
S
 
P
V
 
V
A
 
S
E
 
N
T
 
L
I
 
I
S
 
A
Y
 
Y
L
 
L
S
 
S
G
 
D
L
 
T
V
 
V
E
 
E
L
 
L
F
 
Y
P
 
P
G
 
G
D
 
D
L
 
V
I
 
I
F
 
F
T
 
T
G
 
G
T
 
T
P
 
P
E
 
S
G
 
G
V
 
V
G
 
G
A
 
M
-
 
G
-
 
R
-
 
N
-
 
P
-
 
K
-
 
R
-
 
F
V
 
L
V
 
A
K
 
P
G
 
G
D
 
D
K
 
E
L
 
L
Q
 
R
G
 
T
H
 
Y
V
 
I
D
 
T
G
 
G
L
 
V

8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
35% identity, 91% coverage: 22:227/227 of query aligns to 91:302/303 of 8sutA

query
sites
8sutA
P
 
P
V
 
S
R
 
K
R
 
N
I
 
I
Y
 
I
C
 
C
V
x
I
G
|
G
R
x
K
N
 
N
Y
 
Y
A
 
R
A
 
D
H
|
H
A
 
A
R
 
I
E
 
E
M
 
M
G
 
G
H
 
S
D
 
E
P
 
A
D
 
D
-
 
I
-
 
P
R
 
E
E
 
H
P
 
P
P
 
M
F
 
V
F
|
F
F
 
T
M
 
K
K
 
S
P
 
P
A
 
V
D
 
T
A
 
V
V
 
T
V
 
G
P
 
H
T
 
G
D
 
D
S
 
I
V
 
V
V
 
K
P
 
S
Y
 
H
P
 
E
V
 
E
A
 
V
T
 
T
S
 
S
D
 
Q
Y
 
L
H
 
D
H
 
Y
E
|
E
I
 
G
E
|
E
L
 
L
V
 
A
V
 
V
A
 
V
L
 
I
A
 
G
K
 
K
G
 
S
G
 
G
R
 
T
N
 
R
I
 
I
P
 
S
V
 
K
E
 
E
Q
 
D
A
 
A
L
 
Y
E
 
D
L
 
H
V
 
V
F
 
F
G
 
G
Y
 
Y
A
 
T
V
 
I
G
 
V
L
 
N
D
|
D
M
 
I
T
 
T
R
 
A
R
|
R
D
 
D
I
 
L
Q
|
Q
S
 
K
Q
 
R
A
 
H
K
 
K
K
 
Q
L
 
-
G
 
-
R
 
-
P
 
-
W
 
F
D
 
F
M
 
I
A
 
G
K
|
K
G
 
S
F
 
L
D
 
D
Q
 
T
S
 
T
A
 
C
P
 
P
C
 
M
A
 
G
P
 
P
I
 
V
-
 
L
V
 
V
P
 
H
V
 
K
A
 
S
Q
 
S
A
 
I
G
 
Q
H
 
E
P
 
P
D
 
E
Q
 
R
G
 
L
A
 
K
V
 
V
W
 
E
L
 
T
K
 
R
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
S
G
 
G
D
 
S
L
 
A
A
 
S
D
 
D
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
A
 
P
E
 
E
T
 
L
I
 
I
S
 
E
Y
 
T
L
 
L
S
 
S
G
 
K
L
 
G
V
 
M
E
 
T
L
 
L
F
 
E
P
 
A
G
 
G
D
 
D
L
 
I
I
 
I
F
 
A
T
 
T
G
|
G
T
|
T
P
 
P
E
 
S
G
 
G
V
 
V
G
 
G
A
 
K
-
 
G
-
 
F
-
 
T
-
 
P
-
 
P
-
 
K
-
 
F
V
 
L
V
 
R
K
 
S
G
 
G
D
 
D
K
 
K
L
 
I
Q
 
D
G
 
I
H
 
T
V
 
I
D
 
D
G
 
P
L
 
I
P
 
G
D
 
T
I
 
L
N
 
S
I
 
N
T
 
Q
I
 
I
G
 
G

8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
35% identity, 91% coverage: 22:227/227 of query aligns to 90:301/303 of 8skyB

query
sites
8skyB
P
 
P
V
 
S
R
 
K
R
 
N
I
 
I
Y
 
I
C
 
C
V
x
I
G
|
G
R
 
K
N
 
N
Y
 
Y
A
 
R
A
 
D
H
|
H
A
 
A
R
 
I
E
 
E
M
 
M
G
 
G
H
 
S
D
 
E
P
 
A
D
 
D
-
 
I
-
 
P
R
 
E
E
 
H
P
 
P
P
 
M
F
 
V
F
 
F
F
 
T
M
 
K
K
 
S
P
 
P
A
 
V
D
 
T
A
 
V
V
 
T
V
 
G
P
 
H
T
 
G
D
 
D
S
 
I
V
 
V
V
 
K
P
 
S
Y
 
H
P
 
E
V
 
E
A
 
V
T
 
T
S
 
S
D
 
Q
Y
 
L
H
 
D
H
 
Y
E
|
E
I
 
G
E
|
E
L
 
L
V
 
A
V
 
V
A
 
V
L
 
I
A
 
G
K
 
K
G
 
S
G
 
G
R
 
T
N
 
R
I
 
I
P
 
S
V
 
K
E
 
E
Q
 
D
A
 
A
L
 
Y
E
 
D
L
 
H
V
 
V
F
 
F
G
 
G
Y
 
Y
A
 
T
V
 
I
G
 
V
L
 
N
D
|
D
M
 
I
T
 
T
R
 
A
R
 
R
D
 
D
I
 
L
Q
 
Q
S
 
K
Q
 
R
A
 
H
K
 
K
K
 
Q
L
 
-
G
 
-
R
 
-
P
 
-
W
 
F
D
 
F
M
 
I
A
 
G
K
|
K
G
 
S
F
 
L
D
 
D
Q
 
T
S
 
T
A
 
C
P
 
P
C
 
M
A
 
G
P
 
P
I
 
V
-
 
L
V
 
V
P
 
H
V
 
K
A
 
S
Q
 
S
A
 
I
G
 
Q
H
 
E
P
 
P
D
 
E
Q
 
R
G
 
L
A
 
K
V
 
V
W
 
E
L
 
T
K
 
R
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
S
G
 
G
D
 
S
L
 
A
A
 
S
D
 
D
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
A
 
P
E
 
E
T
 
L
I
 
I
S
 
E
Y
 
T
L
 
L
S
 
S
G
 
K
L
 
G
V
 
M
E
 
T
L
 
L
F
 
E
P
 
A
G
 
G
D
 
D
L
 
I
I
 
I
F
 
A
T
 
T
G
|
G
T
|
T
P
 
P
E
 
S
G
 
G
V
 
V
G
 
G
A
 
K
-
 
G
-
 
F
-
 
T
-
 
P
-
 
P
-
 
K
-
 
F
V
 
L
V
 
R
K
 
S
G
 
G
D
 
D
K
 
K
L
 
I
Q
 
D
G
 
I
H
 
T
V
 
I
D
 
D
G
 
P
L
 
I
P
 
G
D
 
T
I
 
L
N
 
S
I
 
N
T
 
Q
I
 
I
G
 
G

6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
34% identity, 83% coverage: 21:208/227 of query aligns to 66:249/277 of 6iymA

query
sites
6iymA
F
 
L
P
 
P
V
 
P
R
 
R
R
 
N
I
 
V
Y
 
I
C
 
C
V
 
V
G
 
G
R
 
K
N
 
N
Y
 
Y
A
 
A
A
 
D
H
 
H
A
 
I
R
 
K
E
 
E
M
 
M
G
 
D
H
 
T
D
 
A
P
 
G
D
 
A
R
 
G
E
 
K
P
 
F
P
 
V
F
 
L
F
 
F
F
 
T
M
 
K
K
 
A
P
 
P
A
 
S
D
 
S
A
 
I
V
 
V
V
 
G
P
 
P
T
 
F
D
 
D
S
 
P
V
 
I
V
 
E
P
 
R
Y
 
H
P
 
A
V
 
D
A
 
L
T
 
T
S
 
Q
D
 
Q
Y
 
L
H
 
D
H
 
Y
E
|
E
I
 
G
E
|
E
L
 
L
V
 
A
V
 
I
A
 
I
L
 
I
A
 
G
K
 
T
G
 
T
G
 
G
R
 
R
N
 
D
I
 
L
P
 
T
V
 
P
E
 
E
Q
 
N
A
 
A
L
 
L
E
 
E
L
 
H
V
 
V
F
 
F
G
 
G
Y
 
Y
A
 
S
V
 
I
G
 
I
L
 
N
D
|
D
M
 
V
T
 
T
R
 
A
R
 
R
D
 
D
I
 
L
Q
 
Q
S
 
K
Q
 
E
A
 
H
K
 
V
K
 
Q
L
 
F
G
 
F
R
 
R
P
 
-
W
 
-
D
 
-
M
 
-
A
 
G
K
 
K
G
 
S
F
 
L
D
 
D
Q
 
G
S
 
F
A
 
C
P
 
P
C
 
F
A
 
G
P
 
P
I
 
V
V
 
I
P
 
V
V
 
T
A
 
E
Q
 
D
A
 
A
G
 
F
H
 
D
P
 
P
D
 
A
Q
 
D
G
 
V
A
 
L
V
 
V
W
 
E
L
 
T
K
 
R
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
S
G
 
G
D
 
S
L
 
T
A
 
K
D
 
L
L
 
M
I
 
L
W
 
R
S
 
D
V
 
V
A
 
V
E
 
T
T
 
I
I
 
L
S
 
T
Y
 
E
L
 
V
S
 
S
G
 
R
L
 
G
V
 
M
E
 
T
L
 
L
F
 
E
P
 
A
G
 
G
D
 
D
L
 
V
I
 
I
F
 
A
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
V
 
V
G
 
G
A
 
H
V
 
G
V
 
M
K
 
K

3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
31% identity, 86% coverage: 25:219/227 of query aligns to 63:240/252 of 3qdfA

query
sites
3qdfA
R
 
K
I
 
V
Y
 
V
C
 
C
V
 
V
G
 
G
R
 
K
N
 
N
Y
 
Y
A
 
T
A
 
P
H
 
-
A
 
-
R
 
-
E
 
-
M
 
-
G
 
-
H
 
-
D
 
-
P
 
-
D
 
-
R
 
-
E
 
A
P
 
D
P
 
P
F
 
V
F
 
I
F
 
F
M
 
L
K
 
K
P
 
P
A
 
N
D
 
T
A
 
A
V
 
I
V
 
V
P
 
G
T
 
P
D
 
N
S
 
V
V
 
P
V
 
I
P
 
R
Y
 
L
P
 
P
V
 
A
A
 
N
T
 
A
S
 
S
D
 
P
Y
 
V
H
 
H
H
 
F
E
|
E
I
 
G
E
|
E
L
 
L
V
 
A
V
 
I
A
 
V
L
 
I
A
 
G
K
 
R
G
 
P
G
 
C
R
 
K
N
 
D
I
 
V
P
 
S
V
 
A
E
 
A
Q
 
Q
A
 
A
L
 
V
E
 
D
L
 
N
V
 
I
F
 
L
G
 
G
Y
 
Y
A
 
T
V
 
I
G
 
G
L
 
N
D
|
D
M
 
V
T
 
S
R
 
A
R
 
R
D
 
D
I
 
-
Q
 
-
S
 
-
Q
 
Q
A
 
Q
K
 
K
K
 
S
L
 
D
G
 
G
R
 
Q
P
 
-
W
 
W
D
 
T
M
 
R
A
 
A
K
 
K
G
 
G
F
 
H
D
 
D
Q
 
T
S
 
F
A
 
C
P
 
P
C
 
V
A
 
G
P
 
P
I
 
W
V
 
I
P
 
-
V
 
-
A
 
V
Q
 
T
A
 
D
G
 
V
H
 
D
P
 
P
D
 
A
Q
 
D
G
 
L
A
x
E
V
 
L
W
 
R
L
 
T
K
 
E
V
 
V
N
 
N
G
 
G
E
 
A
V
 
V
R
 
K
Q
 
Q
Q
x
H
G
 
A
D
 
R
L
 
T
A
 
S
D
 
L
L
 
M
I
 
I
W
 
H
S
 
D
V
 
V
A
 
G
E
 
A
T
 
I
I
 
V
S
 
E
Y
 
W
L
 
I
S
 
S
G
 
A
L
 
V
V
 
M
E
 
T
L
 
L
F
 
L
P
 
P
G
 
G
D
 
D
L
 
L
I
 
I
F
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
V
 
V
G
 
G
A
 
P
V
 
I
V
 
E
K
 
D
G
 
G
D
 
D
K
 
T
L
 
V
Q
 
S
G
 
I
H
 
T
V
 
I
D
 
E
G
 
G
L
 
I

8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 80% coverage: 23:204/227 of query aligns to 70:248/290 of 8gstC

query
sites
8gstC
V
 
I
R
 
G
R
 
K
I
 
I
Y
 
V
C
 
A
V
x
I
G
|
G
R
 
L
N
 
N
Y
 
Y
A
 
E
A
 
D
H
|
H
A
 
A
R
 
I
E
 
E
M
 
-
G
 
S
H
 
N
D
 
L
P
 
P
D
 
I
R
 
P
E
 
T
P
 
E
P
 
P
F
 
M
F
 
M
F
 
F
M
 
M
K
 
K
P
 
A
A
 
L
D
 
S
A
 
S
V
 
L
V
 
N
-
 
G
P
 
P
T
 
N
D
 
D
S
 
E
V
 
V
V
 
V
P
 
-
Y
 
L
P
 
P
V
 
K
A
 
N
T
 
S
S
 
T
D
 
H
Y
 
G
H
 
D
H
 
W
E
|
E
I
 
V
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
L
 
I
A
 
G
K
 
E
G
 
T
G
 
C
R
 
R
N
 
F
I
 
V
P
 
S
V
 
E
E
 
D
Q
 
E
A
 
A
L
 
L
E
 
S
L
 
K
V
 
V
F
 
A
G
 
G
Y
 
Y
A
 
V
V
 
L
G
 
V
L
 
N
D
|
D
M
 
V
T
 
S
R
 
E
R
 
R
D
 
F
I
 
N
Q
 
Q
S
 
K
Q
 
Q
A
 
R
K
 
-
K
 
-
L
 
-
G
 
G
R
 
T
P
 
Q
W
 
W
D
 
S
M
 
K
A
 
G
K
|
K
G
 
G
F
 
H
D
 
D
Q
 
T
S
 
F
A
 
C
P
 
P
C
 
V
A
 
G
P
 
P
-
 
W
I
 
L
V
 
V
P
 
T
V
 
P
A
 
D
Q
 
E
A
 
V
G
 
G
H
 
D
P
 
P
D
 
Q
Q
 
D
G
 
L
A
 
D
V
 
V
W
 
H
L
 
L
K
 
D
V
 
V
N
 
N
G
 
G
E
 
E
V
 
R
R
 
M
Q
 
Q
Q
 
T
G
 
G
D
 
N
L
 
T
A
 
K
D
 
T
L
 
M
I
 
I
W
 
F
S
 
N
V
 
V
A
 
A
E
 
Q
T
 
L
I
 
I
S
 
S
Y
 
Y
L
 
V
S
 
S
G
 
E
L
 
Y
V
 
I
E
 
T
L
 
L
F
 
Y
P
 
P
G
 
G
D
 
D
L
 
L
I
 
M
F
 
I
T
 
T
G
|
G
T
 
T
P
 
P
E
 
P
G
 
G
V
 
V
G
 
G

8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 80% coverage: 23:204/227 of query aligns to 70:248/290 of 8gsrA

query
sites
8gsrA
V
 
I
R
 
G
R
 
K
I
 
I
Y
 
V
C
 
A
V
 
I
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
E
A
 
D
H
 
H
A
 
A
R
 
I
E
 
E
M
 
-
G
 
S
H
 
N
D
 
L
P
 
P
D
 
I
R
 
P
E
 
T
P
 
E
P
 
P
F
 
M
F
 
M
F
 
F
M
 
M
K
 
K
P
 
A
A
 
L
D
 
S
A
 
S
V
 
L
V
 
N
-
 
G
P
 
P
T
 
N
D
 
D
S
 
E
V
 
V
V
 
V
P
 
-
Y
 
L
P
 
P
V
 
K
A
 
N
T
 
S
S
 
T
D
 
H
Y
 
G
H
 
D
H
 
W
E
|
E
I
 
V
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
L
 
I
A
 
G
K
 
E
G
 
T
G
 
C
R
 
R
N
 
F
I
 
V
P
 
S
V
 
E
E
 
D
Q
 
E
A
 
A
L
 
L
E
 
S
L
 
K
V
 
V
F
 
A
G
 
G
Y
 
Y
A
 
V
V
 
L
G
 
V
L
 
N
D
|
D
M
 
V
T
 
S
R
 
E
R
 
R
D
 
F
I
 
N
Q
 
Q
S
 
K
Q
 
Q
A
 
R
K
 
-
K
 
-
L
 
-
G
 
G
R
 
T
P
 
Q
W
 
W
D
 
S
M
 
K
A
 
G
K
 
K
G
 
G
F
 
H
D
 
D
Q
 
T
S
 
F
A
 
C
P
 
P
C
 
V
A
 
G
P
 
P
-
 
W
I
 
L
V
 
V
P
 
T
V
 
P
A
 
D
Q
 
E
A
 
V
G
 
G
H
 
D
P
 
P
D
 
Q
Q
 
D
G
 
L
A
 
D
V
 
V
W
 
H
L
 
L
K
 
D
V
 
V
N
 
N
G
 
G
E
 
E
V
 
R
R
 
M
Q
 
Q
Q
 
T
G
 
G
D
 
N
L
 
T
A
 
K
D
 
T
L
 
M
I
 
I
W
 
F
S
 
N
V
 
V
A
 
A
E
 
Q
T
 
L
I
 
I
S
 
S
Y
 
Y
L
 
V
S
 
S
G
 
E
L
 
Y
V
 
I
E
 
T
L
 
L
F
 
Y
P
 
P
G
 
G
D
 
D
L
 
L
I
 
M
F
 
I
T
 
T
G
 
G
T
 
T
P
 
P
E
 
P
G
 
G
V
 
V
G
 
G

6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 86% coverage: 32:226/227 of query aligns to 85:260/264 of 6jvwB

query
sites
6jvwB
N
 
N
Y
 
Y
A
 
H
A
 
A
H
 
H
A
 
G
R
 
N
E
 
Q
M
 
-
G
 
-
H
 
-
D
 
-
P
 
-
D
 
-
R
 
-
E
 
-
P
 
-
P
 
-
F
 
G
F
 
F
F
|
F
M
 
L
K
 
K
P
 
P
A
 
G
D
 
S
A
 
A
V
 
L
V
 
S
-
 
G
P
 
P
T
 
T
D
 
D
S
 
P
V
 
V
V
 
V
P
 
L
Y
 
P
P
 
A
V
 
V
A
 
P
T
 
G
S
 
R
D
 
E
Y
 
V
H
 
H
H
 
H
E
|
E
I
 
S
E
|
E
L
 
L
V
 
A
V
 
I
A
 
I
L
 
I
A
 
G
K
 
K
G
 
T
G
 
C
R
 
R
N
 
S
I
 
V
P
 
A
V
 
R
E
 
E
Q
 
D
A
 
W
L
 
K
E
 
D
L
 
V
V
 
V
F
 
F
G
 
G
Y
 
Y
A
 
A
V
 
C
G
 
L
L
 
L
D
|
D
M
 
M
T
 
V
R
 
V
R
 
R
D
 
-
I
 
-
Q
 
-
S
 
-
Q
 
-
A
 
-
K
 
-
K
 
-
L
 
-
G
 
G
R
 
R
P
 
V
W
 
F
D
 
-
M
 
-
A
 
R
K
|
K
G
 
A
F
 
Y
D
 
D
Q
 
T
S
 
F
A
 
C
P
 
P
C
 
V
A
 
G
P
 
P
I
 
W
V
 
I
P
 
T
V
 
T
A
 
A
Q
 
D
A
 
A
-
 
V
G
 
N
H
 
D
P
 
P
D
 
A
Q
 
T
G
 
L
A
 
D
V
 
M
W
 
K
L
 
L
K
 
W
V
 
V
N
 
N
G
 
D
E
 
D
V
 
L
R
 
R
Q
 
Q
Q
 
K
G
 
A
D
 
N
L
 
T
A
 
R
D
 
D
L
 
L
I
 
V
W
 
L
S
 
D
V
 
I
A
 
P
E
 
G
T
 
M
I
 
I
S
 
A
Y
 
T
L
 
A
S
 
S
G
 
A
L
 
V
V
 
M
E
 
T
L
 
L
F
 
Q
P
 
P
G
 
G
D
 
D
L
 
I
I
 
I
F
 
A
T
 
T
G
 
G
T
 
T
P
 
P
E
 
E
G
 
G
V
 
V
G
 
G
A
 
P
V
 
V
V
 
V
K
 
D
G
 
G
D
 
D
K
 
R
L
 
I
Q
 
R
G
 
I
H
 
V
V
 
I
D
 
D
G
 
Q
L
 
V
P
 
G
D
 
E
I
 
M
N
 
A
I
 
V
T
 
D
I
 
V

Sites not aligning to the query:

1gttA Crystal structure of hpce (see paper)
36% identity, 79% coverage: 26:204/227 of query aligns to 225:392/421 of 1gttA

query
sites
1gttA
I
 
L
Y
 
F
C
 
A
V
 
L
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
A
A
 
D
H
 
H
A
 
P
R
 
E
E
 
E
M
 
-
G
 
-
H
 
-
D
 
-
P
 
-
D
 
-
R
 
-
E
 
-
P
 
-
P
 
P
F
 
L
F
 
V
F
 
F
M
 
L
K
 
K
P
 
A
A
 
P
D
 
N
A
 
T
V
 
L
V
 
T
P
 
G
T
 
D
D
 
N
S
 
Q
V
 
T
V
 
S
P
 
V
Y
 
R
P
 
P
V
 
N
A
 
N
T
 
I
S
 
E
D
 
Y
Y
 
M
H
 
H
H
 
Y
E
|
E
I
 
A
E
|
E
L
 
L
V
 
V
V
 
V
A
 
V
L
 
I
A
 
G
K
 
K
G
 
Q
G
 
A
R
 
R
N
 
N
I
 
V
P
 
S
V
 
E
E
 
A
Q
 
D
A
 
A
L
 
M
E
 
D
L
 
Y
V
 
V
F
 
A
G
 
G
Y
 
Y
A
 
T
V
 
V
G
 
C
L
 
N
D
|
D
M
 
Y
T
 
A
R
 
I
R
 
R
D
 
D
I
 
Y
Q
 
-
S
 
-
Q
 
-
A
 
L
K
 
E
K
 
N
L
 
Y
G
 
Y
R
 
R
P
 
P
W
 
N
D
 
L
M
 
R
A
 
V
K
 
K
G
 
S
F
 
R
D
 
D
Q
 
G
S
 
L
A
 
T
P
 
P
-
 
M
C
 
L
A
 
S
P
 
T
I
 
I
V
 
V
P
 
P
V
 
K
A
 
E
Q
 
A
A
 
I
G
 
P
H
 
D
P
 
P
D
 
H
Q
 
N
G
 
L
A
 
T
V
 
L
W
 
R
L
 
T
K
 
F
V
 
V
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
Q
G
 
G
D
 
T
L
 
T
A
 
A
D
 
D
L
 
L
I
 
I
W
 
F
S
 
S
V
 
V
A
 
P
E
 
F
T
 
L
I
 
I
S
 
A
Y
 
Y
L
 
L
S
 
S
G
 
E
L
 
F
V
 
M
E
 
T
L
 
L
F
 
N
P
 
P
G
 
G
D
 
D
L
 
M
I
 
I
F
 
A
T
 
T
G
 
G
T
 
T
P
 
P
E
 
K
G
 
G
V
 
L
G
 
S

6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 80% coverage: 24:204/227 of query aligns to 68:247/280 of 6j5xB

query
sites
6j5xB
R
 
K
R
 
K
I
 
I
Y
 
V
C
 
C
V
|
V
G
|
G
R
 
L
N
 
N
Y
 
Y
A
 
A
A
 
N
H
|
H
A
 
I
R
 
K
E
 
E
M
 
M
G
 
G
H
 
R
D
 
D
-
 
L
P
 
P
D
 
D
R
 
T
E
 
-
P
 
-
P
 
P
F
 
T
F
 
L
F
|
F
M
 
V
K
 
K
P
 
F
A
 
P
D
 
D
A
 
A
V
 
L
V
 
I
-
 
G
P
 
P
T
 
F
D
 
D
S
 
D
V
 
V
V
 
V
P
 
V
Y
 
P
P
 
E
V
 
W
A
 
A
T
 
N
S
 
K
D
 
A
Y
 
L
H
 
D
H
 
W
E
|
E
I
 
G
E
|
E
L
 
M
V
 
A
V
 
V
A
 
I
L
 
I
A
 
G
K
 
K
G
 
R
G
 
A
R
 
R
N
 
R
I
 
V
P
 
K
V
 
Q
E
 
A
Q
 
D
A
 
A
L
 
A
E
 
E
L
 
Y
V
 
I
F
 
A
G
 
G
Y
 
Y
A
 
A
V
 
V
G
 
M
L
 
N
D
|
D
M
 
Y
T
 
T
R
 
T
R
 
R
D
 
D
I
 
F
Q
 
Q
S
 
Y
Q
 
A
A
 
A
K
 
P
K
 
A
L
 
K
G
 
T
R
 
P
P
 
Q
W
|
W
D
 
H
M
 
Q
A
 
G
K
|
K
G
 
S
F
 
L
D
 
E
Q
 
K
S
 
S
A
 
A
P
 
G
C
 
F
A
 
G
P
 
P
I
 
W
V
 
M
P
 
T
V
 
T
A
 
-
Q
 
-
A
 
-
G
 
-
H
 
-
P
 
P
D
 
D
Q
 
S
-
 
F
-
 
E
-
 
F
-
 
G
G
 
G
A
 
E
V
 
L
W
 
A
L
 
T
K
 
Y
V
 
L
N
 
E
G
 
G
E
 
E
V
 
K
R
 
V
Q
 
Q
Q
 
S
G
 
T
D
 
P
L
 
T
A
 
N
D
 
D
L
 
L
I
 
V
W
 
F
S
 
S
V
 
P
A
 
E
E
 
K
T
 
L
I
 
I
S
 
E
Y
 
Y
L
 
I
S
 
T
G
 
H
L
 
I
V
 
Y
E
 
P
L
 
L
F
 
D
P
 
A
G
 
G
D
 
D
L
 
V
I
 
I
F
 
V
T
 
T
G
|
G
T
|
T
P
 
P
E
 
G
G
 
G
V
 
V
G
 
G

6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 80% coverage: 24:204/227 of query aligns to 68:247/280 of 6j5xA

query
sites
6j5xA
R
 
K
R
 
K
I
 
I
Y
 
V
C
 
C
V
 
V
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
A
A
 
N
H
 
H
A
 
I
R
 
K
E
 
E
M
 
M
G
 
G
H
 
R
D
 
D
-
 
L
P
 
P
D
 
D
R
 
T
E
 
-
P
 
-
P
 
P
F
 
T
F
 
L
F
 
F
M
 
V
K
 
K
P
 
F
A
 
P
D
 
D
A
 
A
V
 
L
V
 
I
-
 
G
P
 
P
T
 
F
D
 
D
S
 
D
V
 
V
V
 
V
P
 
V
Y
 
P
P
 
E
V
 
W
A
 
A
T
 
N
S
 
K
D
 
A
Y
 
L
H
 
D
H
 
W
E
|
E
I
 
G
E
|
E
L
 
M
V
 
A
V
 
V
A
 
I
L
 
I
A
 
G
K
 
K
G
 
R
G
 
A
R
 
R
N
 
R
I
 
V
P
 
K
V
 
Q
E
 
A
Q
 
D
A
 
A
L
 
A
E
 
E
L
 
Y
V
 
I
F
 
A
G
 
G
Y
 
Y
A
 
A
V
 
V
G
 
M
L
 
N
D
|
D
M
 
Y
T
 
T
R
 
T
R
 
R
D
 
D
I
 
F
Q
 
Q
S
 
Y
Q
 
A
A
 
A
K
 
P
K
 
A
L
 
K
G
 
T
R
 
P
P
 
Q
W
 
W
D
 
H
M
 
Q
A
 
G
K
 
K
G
 
S
F
 
L
D
 
E
Q
 
K
S
 
S
A
 
A
P
 
G
C
 
F
A
 
G
P
 
P
I
 
W
V
 
M
P
 
T
V
 
T
A
 
-
Q
 
-
A
 
-
G
 
-
H
 
-
P
 
P
D
 
D
Q
 
S
-
 
F
-
 
E
-
 
F
-
 
G
G
 
G
A
 
E
V
 
L
W
 
A
L
 
T
K
 
Y
V
 
L
N
 
E
G
 
G
E
 
E
V
 
K
R
 
V
Q
 
Q
Q
 
S
G
 
T
D
 
P
L
 
T
A
 
N
D
 
D
L
 
L
I
 
V
W
 
F
S
 
S
V
 
P
A
 
E
E
 
K
T
 
L
I
 
I
S
 
E
Y
 
Y
L
 
I
S
 
T
G
 
H
L
 
I
V
 
Y
E
 
P
L
 
L
F
 
D
P
 
A
G
 
G
D
 
D
L
 
V
I
 
I
F
 
V
T
 
T
G
 
G
T
 
T
P
 
P
E
 
G
G
 
G
V
 
V
G
 
G

4dbhA Crystal structure of cg1458 with inhibitor (see paper)
27% identity, 86% coverage: 25:219/227 of query aligns to 63:259/269 of 4dbhA

query
sites
4dbhA
R
 
K
I
 
V
Y
 
V
C
 
A
V
 
I
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
R
 
A
E
 
E
M
 
V
-
 
F
G
 
K
H
 
K
D
 
S
P
 
A
D
 
E
R
 
S
E
 
L
P
 
P
P
 
P
F
 
T
F
 
L
F
|
F
M
 
L
K
 
K
P
 
P
A
 
P
D
 
T
A
 
A
V
 
V
V
 
T
P
 
G
T
 
P
D
 
E
S
 
S
V
 
P
V
 
I
P
 
R
Y
 
I
P
 
P
V
 
S
A
 
F
T
 
A
S
 
T
D
 
K
Y
 
V
H
 
E
H
 
F
E
|
E
I
 
G
E
|
E
L
 
L
V
 
A
V
 
V
A
 
V
L
 
I
A
 
G
K
 
K
G
 
P
G
 
C
R
 
K
N
 
N
I
 
V
P
 
K
V
 
A
E
 
D
Q
 
D
A
 
W
L
 
K
E
 
S
L
 
V
V
 
V
F
 
L
G
 
G
Y
 
F
A
 
T
V
 
I
G
 
I
L
 
N
D
|
D
M
 
V
T
 
S
R
 
S
R
 
R
D
 
D
I
 
L
Q
 
Q
S
 
F
Q
 
A
A
 
D
K
 
G
K
 
Q
L
 
-
G
 
-
R
 
-
P
 
-
W
 
W
D
 
A
M
 
R
A
 
A
K
|
K
G
 
G
F
 
I
D
 
D
Q
 
T
S
 
F
A
 
G
P
 
P
C
 
I
A
 
G
P
 
P
-
 
W
-
 
I
-
 
E
-
 
T
-
 
D
I
 
I
V
 
N
P
 
S
V
 
I
A
 
D
Q
 
L
A
 
D
G
 
N
H
 
L
P
 
P
D
 
I
Q
 
K
G
 
A
A
 
R
V
 
L
W
 
T
L
 
H
K
 
D
V
 
G
N
 
E
G
 
T
E
 
Q
V
 
L
R
 
K
Q
 
Q
Q
 
D
G
 
S
D
 
N
L
 
S
A
 
N
D
 
Q
L
 
M
I
 
I
W
 
M
S
 
K
V
 
M
A
 
G
E
 
E
T
 
I
I
 
I
S
 
E
Y
 
F
L
 
I
S
 
T
G
 
A
L
 
S
V
 
M
E
 
T
L
 
L
F
 
L
P
 
P
G
 
G
D
 
D
L
 
V
I
 
I
F
 
A
T
 
T
G
 
G
T
x
S
P
 
P
E
 
A
G
 
G
V
 
T
G
 
E
A
 
A
V
 
M
V
 
V
K
 
D
G
 
G
D
 
D
K
 
Y
L
 
I
Q
 
E
G
 
I
H
 
E
V
 
I
D
 
P
G
 
G
L
 
I

3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
29% identity, 79% coverage: 25:204/227 of query aligns to 64:231/265 of 3r6oA

query
sites
3r6oA
R
 
Q
I
 
V
Y
 
I
C
 
A
V
 
L
G
 
G
R
 
F
N
 
N
Y
 
Y
A
 
P
A
 
T
H
 
H
A
 
-
R
 
-
E
 
-
M
 
-
G
 
-
H
 
-
D
 
-
P
 
-
D
 
-
R
 
-
E
 
D
P
 
P
P
 
V
F
 
V
F
 
F
F
 
M
M
 
K
K
 
S
P
 
P
A
 
T
D
 
S
A
 
I
V
 
S
V
 
G
P
 
P
T
 
R
D
 
D
S
 
A
V
 
V
V
 
I
P
 
-
Y
 
A
P
 
P
V
 
R
A
 
T
T
 
S
S
 
H
D
 
A
Y
 
L
H
 
D
H
 
Y
E
|
E
I
 
I
E
|
E
L
 
I
V
 
A
V
 
V
A
 
V
L
 
I
A
 
G
K
 
K
G
 
P
G
 
G
R
 
Y
N
 
R
I
 
I
P
 
E
V
 
R
E
 
S
Q
 
Q
A
 
A
L
 
I
E
 
K
L
 
H
V
 
V
F
 
A
G
 
G
Y
 
Y
A
 
M
V
 
L
G
 
A
L
 
N
D
|
D
M
 
I
T
 
T
R
 
A
R
 
R
D
 
D
I
 
V
-
 
A
-
 
L
-
 
P
-
 
F
-
 
G
Q
 
Q
S
 
A
Q
 
Q
A
 
V
K
 
V
K
 
R
L
 
-
G
 
-
R
 
-
P
 
-
W
 
-
D
 
-
M
 
-
A
 
G
K
 
K
G
 
G
F
 
Y
D
 
P
Q
 
T
S
 
F
A
 
C
P
 
P
C
 
T
A
 
G
P
 
P
-
 
W
I
 
L
V
 
F
P
 
T
V
 
T
A
 
G
Q
 
S
A
 
D
G
 
T
H
 
T
P
 
F
D
 
E
Q
 
T
G
 
F
A
 
D
V
 
F
W
 
E
L
 
L
K
 
R
V
 
I
N
 
N
G
 
G
E
 
E
V
 
L
R
 
R
Q
 
Q
Q
 
S
G
 
G
D
 
S
L
 
T
A
 
V
D
 
D
L
 
M
I
 
T
W
 
L
S
 
G
V
 
F
A
 
A
E
 
E
T
 
V
I
 
V
S
 
E
Y
 
T
L
 
V
S
 
S
G
 
A
L
 
T
V
 
I
E
 
A
L
 
L
F
 
R
P
 
A
G
 
G
D
 
D
L
 
I
I
 
I
F
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
G
G
 
G
V
 
C
G
 
G

Query Sequence

>HSERO_RS17860 FitnessBrowser__HerbieS:HSERO_RS17860
MSFAIPAPAQATVAVVGGAAFPVRRIYCVGRNYAAHAREMGHDPDREPPFFFMKPADAVV
PTDSVVPYPVATSDYHHEIELVVALAKGGRNIPVEQALELVFGYAVGLDMTRRDIQSQAK
KLGRPWDMAKGFDQSAPCAPIVPVAQAGHPDQGAVWLKVNGEVRQQGDLADLIWSVAETI
SYLSGLVELFPGDLIFTGTPEGVGAVVKGDKLQGHVDGLPDINITIG

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory