Comparing HSERO_RS18245 FitnessBrowser__HerbieS:HSERO_RS18245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
34% identity, 70% coverage: 37:233/282 of query aligns to 49:255/305 of Q8K4H1
Sites not aligning to the query:
4oukX Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
29% identity, 51% coverage: 58:201/282 of query aligns to 45:199/309 of 4oukX
Sites not aligning to the query:
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
31% identity, 46% coverage: 58:186/282 of query aligns to 48:182/309 of 4po3X
Sites not aligning to the query:
4n5iX Crystal structure of a c8-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
31% identity, 46% coverage: 58:186/282 of query aligns to 45:179/311 of 4n5iX
Sites not aligning to the query:
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
41% identity, 33% coverage: 71:162/282 of query aligns to 63:156/307 of 6ieyA
Sites not aligning to the query:
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
36% identity, 34% coverage: 64:159/282 of query aligns to 63:161/309 of 1qz3A
Sites not aligning to the query:
Q7M370 Arylacetamide deacetylase; 50 kDa microsomal esterase/N-deacetylase; EC 3.1.1.3 from Oryctolagus cuniculus (Rabbit) (see 3 papers)
29% identity, 45% coverage: 37:164/282 of query aligns to 68:200/398 of Q7M370
Sites not aligning to the query:
6xycA Truncated form of carbohydrate esterase from gut microbiota (see paper)
27% identity, 44% coverage: 44:166/282 of query aligns to 6:135/285 of 6xycA
Sites not aligning to the query:
4v2iA Biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp (see paper)
24% identity, 41% coverage: 47:162/282 of query aligns to 49:167/315 of 4v2iA
Sites not aligning to the query:
4ob6A Complex structure of esterase rppe s159a/w187h and substrate (s)-ac- cpa (see paper)
27% identity, 32% coverage: 73:162/282 of query aligns to 80:170/319 of 4ob6A
Sites not aligning to the query:
P24484 Lipase 2; Triacylglycerol lipase; EC 3.1.1.3 from Moraxella sp. (strain TA144) (see paper)
33% identity, 35% coverage: 75:174/282 of query aligns to 161:260/433 of P24484
5mifC Crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum (see paper)
29% identity, 30% coverage: 73:156/282 of query aligns to 64:148/301 of 5mifC
Sites not aligning to the query:
7bfrA Thermogutta terrifontis esterase 2 phosphorylated by paraoxon (see paper)
30% identity, 32% coverage: 71:159/282 of query aligns to 39:129/260 of 7bfrA
Sites not aligning to the query:
5aocA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound (see paper)
30% identity, 32% coverage: 71:159/282 of query aligns to 43:133/277 of 5aocA
Sites not aligning to the query:
P71668 Esterase LipI; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 33% coverage: 70:162/282 of query aligns to 82:175/320 of P71668
Sites not aligning to the query:
5aobA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound (see paper)
30% identity, 32% coverage: 71:159/282 of query aligns to 39:129/278 of 5aobA
P23872 Acetyl esterase; EcE; EC 3.1.1.- from Escherichia coli (strain K12) (see paper)
37% identity, 30% coverage: 75:158/282 of query aligns to 87:171/319 of P23872
Sites not aligning to the query:
P15304 Hormone-sensitive lipase; HSL; Monoacylglycerol lipase LIPE; Retinyl ester hydrolase; REH; EC 3.1.1.79; EC 3.1.1.23 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 32% coverage: 72:162/282 of query aligns to 642:733/1068 of P15304
Sites not aligning to the query:
P22760 Arylacetamide deacetylase; EC 3.1.1.3 from Homo sapiens (Human) (see 6 papers)
27% identity, 43% coverage: 43:164/282 of query aligns to 75:201/399 of P22760
Sites not aligning to the query:
P95125 Carboxylic ester hydrolase LipN; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 34% coverage: 65:161/282 of query aligns to 126:225/376 of P95125
Sites not aligning to the query:
>HSERO_RS18245 FitnessBrowser__HerbieS:HSERO_RS18245
ISTDTRRVLCPVAECEAGYNLKAAFPDFPQVLQQWQQATAAIADTLLTESDISYGDAPLQ
RFDFYRAEGAQRPLLVFIHGGYWQGGDKRDIGFIAAPYVKAGISVAVINYSLAPQARIED
MVKEVQACLSTIAQQAERLGIDVDRISLMGHSAGGHLAAFVAAQPGRMPVQAVFAISGVF
DLAPLIPTSLNKALTLDQVRADALSPVLQTGPAQTRVHTIIGELETLQFHLQAAVMANCW
PQVVAHHVVPDTHHYTVLFPLADADSSVCRAVIAEMNSAGRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory