Comparing HSERO_RS18275 FitnessBrowser__HerbieS:HSERO_RS18275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
36% identity, 60% coverage: 122:336/360 of query aligns to 99:315/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
36% identity, 60% coverage: 122:336/360 of query aligns to 98:314/333 of 5ogxA
Sites not aligning to the query:
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
42% identity, 27% coverage: 3:100/360 of query aligns to 4:101/104 of P0A185
Sites not aligning to the query:
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
42% identity, 27% coverage: 3:100/360 of query aligns to 3:100/103 of 2qpzA
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
27% identity, 94% coverage: 13:352/360 of query aligns to 19:334/337 of 1krhA
Sites not aligning to the query:
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
39% identity, 26% coverage: 4:98/360 of query aligns to 3:97/102 of 5bokA
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
27% identity, 45% coverage: 167:328/360 of query aligns to 83:256/279 of 7qu0A
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
27% identity, 45% coverage: 167:328/360 of query aligns to 83:256/279 of 7qtyA
Sites not aligning to the query:
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
46% identity, 23% coverage: 12:93/360 of query aligns to 11:93/109 of 1fqtA
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
25% identity, 45% coverage: 167:328/360 of query aligns to 83:255/280 of 7qu5A
Sites not aligning to the query:
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
25% identity, 45% coverage: 167:328/360 of query aligns to 83:255/279 of 7qu3A
Sites not aligning to the query:
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
38% identity, 28% coverage: 4:105/360 of query aligns to 5:105/107 of Q8GI16
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
41% identity, 24% coverage: 15:100/360 of query aligns to 13:99/102 of 2i7fA
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
37% identity, 27% coverage: 4:100/360 of query aligns to 4:101/114 of 4nbbE
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
35% identity, 27% coverage: 4:100/360 of query aligns to 2:98/106 of 3dqyA
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
23% identity, 53% coverage: 162:352/360 of query aligns to 81:288/289 of 2r6hC
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
31% identity, 51% coverage: 149:332/360 of query aligns to 42:225/250 of 1tvcA
Sites not aligning to the query:
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
24% identity, 66% coverage: 117:352/360 of query aligns to 101:333/334 of 7c3bC
Sites not aligning to the query:
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
38% identity, 23% coverage: 11:93/360 of query aligns to 9:92/108 of 2e4pA
Sites not aligning to the query:
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
26% identity, 54% coverage: 141:334/360 of query aligns to 120:307/326 of 4wqmA
Sites not aligning to the query:
>HSERO_RS18275 FitnessBrowser__HerbieS:HSERO_RS18275
MSEWFDVGHADDFAEGEVAAARAGGQAVAVFRLGEEIFALKDLCTHGNAKLSDGYVEDGC
VECPLHQGLFDIRSGAPRCAPVTEAVRSFPVRVVAGRVEIGVGGEGGGGDVLTVASPAPA
AQQVQATLESLTRAAPDVAILRLRCAAPLSYRAGQYIDLLLEDGQRRSYSMATYAKDGSD
LLELHVRHLPGGLFTDRLFNGMQPGQQFSLEGPAGSFFMREGTQPLILLASGTGFAPVKA
LVEEAIASGSTRAMRLYWGGRRAADLYLDALCRDWAASLPWFDYVPVLSEADATSGWSGR
TGLVHRAVMQDVPAMQQYQVYACGAPVVVESARRDFTAACGLSETAFFADAFVSRADLRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory