Comparing HSERO_RS18295 FitnessBrowser__HerbieS:HSERO_RS18295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
55% identity, 100% coverage: 2:303/303 of query aligns to 5:309/309 of 2xsrA
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
52% identity, 97% coverage: 10:302/303 of query aligns to 13:308/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
52% identity, 97% coverage: 10:302/303 of query aligns to 13:308/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
52% identity, 97% coverage: 10:302/303 of query aligns to 13:308/309 of 1dlmA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
52% identity, 97% coverage: 10:302/303 of query aligns to 15:310/311 of P07773
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
53% identity, 97% coverage: 6:300/303 of query aligns to 9:304/309 of 2azqA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
50% identity, 100% coverage: 2:303/303 of query aligns to 6:308/310 of 5umhB
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
50% identity, 99% coverage: 2:300/303 of query aligns to 5:304/307 of 5td3A
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
52% identity, 92% coverage: 24:303/303 of query aligns to 31:311/312 of 5vxtB
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
33% identity, 86% coverage: 24:284/303 of query aligns to 4:250/253 of 2boyA
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
32% identity, 89% coverage: 4:273/303 of query aligns to 2:265/286 of 3n9tA
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
34% identity, 83% coverage: 32:284/303 of query aligns to 15:253/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
34% identity, 83% coverage: 32:284/303 of query aligns to 15:253/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
34% identity, 83% coverage: 32:284/303 of query aligns to 15:253/256 of 3o32A
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
35% identity, 76% coverage: 56:286/303 of query aligns to 43:257/258 of 3hgiA
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
35% identity, 76% coverage: 56:286/303 of query aligns to 41:255/256 of 3i51A
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
35% identity, 76% coverage: 56:286/303 of query aligns to 41:255/256 of 3i4yA
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
35% identity, 76% coverage: 56:286/303 of query aligns to 41:255/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
35% identity, 76% coverage: 56:286/303 of query aligns to 41:255/256 of 3hjsA
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
35% identity, 76% coverage: 56:286/303 of query aligns to 41:255/256 of 3hjqA
>HSERO_RS18295 FitnessBrowser__HerbieS:HSERO_RS18295
VDKKAIDAVLQKIESTELAEGNQRVKTVVNRLVRDMFYTIEELDVQPEEFWAAVDYLTSA
GKSGEFGLIAAGLGFEHFLDLRMDEAEARRGVQGGTPRTIEGPLYVSGAPEQKGFARMDK
DPQPGDTLFMQGQVFDEHGKPLANALVEVWHANHLGRYSFFDPDQSPFNLRCSIRTDEQG
RYRFRSRVPVGYSVPPGGATDRLLTKLGRHGSRPAHIHFFVTVPGYRKLTTQINIAGDPY
LWDDFAFATREGLVPELKHVTDPAEIRKHEVDAPFYAIEFNFNLLPEQADLPKADINRPR
LAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory