Comparing HSERO_RS18425 FitnessBrowser__HerbieS:HSERO_RS18425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
41% identity, 95% coverage: 2:281/295 of query aligns to 4:284/293 of 4wjiA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
41% identity, 88% coverage: 3:261/295 of query aligns to 6:263/286 of 3ggpA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
40% identity, 88% coverage: 3:262/295 of query aligns to 14:272/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
41% identity, 88% coverage: 3:261/295 of query aligns to 6:263/285 of 3ggoA
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
37% identity, 94% coverage: 3:280/295 of query aligns to 10:287/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
37% identity, 94% coverage: 3:280/295 of query aligns to 2:279/365 of 6u60B
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
33% identity, 95% coverage: 3:282/295 of query aligns to 7:284/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
29% identity, 95% coverage: 4:283/295 of query aligns to 2:277/279 of 2f1kA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
24% identity, 82% coverage: 1:243/295 of query aligns to 9:226/280 of 2pv7B
>HSERO_RS18425 FitnessBrowser__HerbieS:HSERO_RS18425
VFKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAV
QGADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPA
HPIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHD
AVFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANR
DALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQWAAAIEAAERKAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory