SitesBLAST
Comparing HSERO_RS18505 FitnessBrowser__HerbieS:HSERO_RS18505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P21213 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Rattus norvegicus (Rat) (see paper)
33% identity, 97% coverage: 15:524/526 of query aligns to 114:615/657 of P21213
- S254 (= S157) mutation to A: Complete loss of activity.
Q20502 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Caenorhabditis elegans (see paper)
35% identity, 94% coverage: 25:518/526 of query aligns to 140:624/677 of Q20502
- D536 (≠ F420) mutation to N: In am130; causes strong resistance to nickel and zinc toxicity.
Q8GMG0 MIO-dependent tyrosine 2,3-aminomutase; Tyrosine ammonia-lyase; EC 5.4.3.6; EC 4.3.1.23 from Streptomyces globisporus (see 3 papers)
37% identity, 86% coverage: 13:464/526 of query aligns to 11:477/539 of Q8GMG0
- Y63 (= Y67) active site, Proton donor/acceptor; mutation to F: Complete loss of activity. It does not affect the over-all structure of the enzyme.
- E71 (≠ D75) mutation to A: Despite a decrease in activity, it shows lyase activity over time and still produced some amount of beta-tyrosine.
- H93 (= H97) binding ; mutation to F: Complete loss of activity.
- A152 (= A156) modified: Crosslink with 154, 5-imidazolinone (Ala-Gly)
- S153 (= S157) modified: 2,3-didehydroalanine (Ser)
- G154 (= G158) modified: Crosslink with 152, 5-imidazolinone (Ala-Gly)
- N205 (= N209) binding
- Y303 (≠ R285) mutation to A: Despite a decrease in activity, it shows lyase activity over time and still produced some amount of beta-tyrosine.
- R311 (= R293) binding
- Y415 (≠ I401) mutation to V: Complete loss of activity.
P0DO55 Phenylalanine/tyrosine ammonia-lyase 1; FuPAL1; EC 4.3.1.25 from Fritillaria unibracteata (Sichuan fritillary) (see paper)
33% identity, 86% coverage: 15:467/526 of query aligns to 63:532/722 of P0DO55
- F141 (≠ E88) mutation to H: Increased activity toward L-tyrosine (L-Tyr) but reduced ability to use L-phenylalanine (L-Phe) as substrate.
- S208 (≠ A156) mutation to A: Higher binding affinity for L-phenylalanine (L-Phe) and decrease catalytic efficiency.
- I218 (≠ L166) mutation to P: Higher binding affinity for L-phenylalanine (L-Phe) and decrease catalytic efficiency.
- E490 (= E425) mutation to N: Higher binding affinity for L-phenylalanine (L-Phe) and decrease catalytic efficiency.
2rjsA Sgtam bound to substrate mimic (see paper)
37% identity, 86% coverage: 14:464/526 of query aligns to 1:464/526 of 2rjsA
- active site: Y52 (= Y67), G59 (= G74), H82 (= H97), N192 (= N209), Y295 (= Y290), R298 (= R293), F343 (= F339), Q429 (= Q429)
- binding (3R)-3-amino-2,2-difluoro-3-(4-methoxyphenyl)propanoic acid: Y52 (= Y67), G59 (= G74), H82 (= H97), G141 (= G158), L143 (= L160), N192 (= N209), Y295 (= Y290), R298 (= R293), F343 (= F339), Q429 (= Q429)
2rjrA Substrate mimic bound to sgtam (see paper)
37% identity, 86% coverage: 14:464/526 of query aligns to 1:464/526 of 2rjrA
- active site: Y52 (= Y67), G59 (= G74), H82 (= H97), N192 (= N209), Y295 (= Y290), R298 (= R293), F343 (= F339), Q429 (= Q429)
- binding (2S,3S)-3-(4-fluorophenyl)-2,3-dihydroxypropanoic acid: Y52 (= Y67), G59 (= G74), H82 (= H97), G141 (= G158), L143 (= L160), N192 (= N209), F343 (= F339), Q429 (= Q429)
2qveA Crystal structure of sgtam bound to mechanism based inhibitor (see paper)
37% identity, 86% coverage: 14:464/526 of query aligns to 1:464/526 of 2qveA
- active site: Y52 (= Y67), G59 (= G74), H82 (= H97), N192 (= N209), Y295 (= Y290), R298 (= R293), F343 (= F339), Q429 (= Q429)
- binding (3R)-3-amino-2,2-difluoro-3-(4-hydroxyphenyl)propanoic acid: Y52 (= Y67), G59 (= G74), H82 (= H97), G141 (= G158), L143 (= L160), N192 (= N209), Y295 (= Y290), R298 (= R293), F343 (= F339), Q429 (= Q429)
Q6GZ04 Phenylalanine aminomutase (L-beta-phenylalanine forming); Phenylalanine ammonia-lyase; EC 5.4.3.10; EC 4.3.1.24 from Taxus canadensis (Canadian yew) (see paper)
35% identity, 86% coverage: 18:467/526 of query aligns to 31:497/698 of Q6GZ04
- Y80 (= Y67) mutation to F: Abolishes enzyme activity.
- L104 (= L93) mutation to A: Decreases enzyme activity.
- Q319 (= Q287) binding
- R325 (= R293) binding
Q68G84 Phenylalanine aminomutase (L-beta-phenylalanine forming); Phenylalanine ammonia-lyase; EC 5.4.3.10; EC 4.3.1.24 from Taxus chinensis (Chinese yew) (Taxus wallichiana var. chinensis) (see 2 papers)
35% identity, 86% coverage: 18:467/526 of query aligns to 31:497/687 of Q68G84
- Y80 (= Y67) active site, Proton donor/acceptor; mutation Y->A,F: Abolishes enzyme activity.
- A175 (= A156) modified: Crosslink with 177, 5-imidazolinone (Ala-Gly)
- S176 (= S157) modified: 2,3-didehydroalanine (Ser)
- G177 (= G158) modified: Crosslink with 175, 5-imidazolinone (Ala-Gly)
- N231 (= N209) binding ; mutation to A: Abolishes the formation of the MIO cofactor and thereby abolishes enzyme activity.; mutation to X: Abolishes enzyme activity; when associated with X-355.
- Q319 (= Q287) binding ; mutation to M: Increases deamination activity with beta-Phe. Increases beta-regioselectivity in the amination of cinnamate. Abolishes enzyme activity; when associated with K-325.
- Y322 (= Y290) mutation to A: Abolishes the formation of the MIO cofactor and thereby abolishes enzyme activity.; mutation to X: Abolishes enzyme activity; when associated with X-371.
- R325 (= R293) binding ; mutation to K: Increases deamination activity with beta-Phe. Increases beta-regioselectivity in the amination of cinnamate. Abolishes enzyme activity; when associated with M-319.
- N355 (= N323) binding ; mutation to X: Abolishes enzyme activity; when associated with X-231.
- F371 (= F339) mutation to X: Abolishes enzyme activity; when associated with X-322.
- N458 (= N428) binding
3kdzA X-ray crystal structure of a tyrosine aminomutase mutant construct with bound ligand (see paper)
36% identity, 86% coverage: 13:464/526 of query aligns to 1:465/527 of 3kdzA
- active site: F53 (≠ Y67), G60 (= G74), H83 (= H97), N193 (= N209), Y296 (= Y290), R299 (= R293), F344 (= F339), Q430 (= Q429)
- binding tyrosine: F53 (≠ Y67), Y59 (= Y73), G60 (= G74), H83 (= H97), G142 (= G158), N193 (= N209), Y296 (= Y290), R299 (= R293), F344 (= F339)
3unvA Pantoea agglomerans phenylalanine aminomutase (see paper)
32% identity, 85% coverage: 19:467/526 of query aligns to 7:467/514 of 3unvA
- active site: Y53 (= Y67), G60 (= G74), V83 (≠ H97), L191 (≠ I207), D291 (= D288), S294 (= S291), G340 (= G337), D427 (≠ H427)
- binding phenylalanine: Y53 (= Y67), G60 (= G74), G142 (= G158), L144 (= L160), N326 (= N323), F342 (= F339)
- binding (3S)-3-amino-3-phenylpropanoic acid: Y53 (= Y67), G60 (= G74), G142 (= G158), N193 (= N209), N326 (= N323), F342 (= F339)
P24481 Phenylalanine ammonia-lyase 1; EC 4.3.1.24 from Petroselinum crispum (Parsley) (Petroselinum hortense) (see paper)
32% identity, 88% coverage: 15:476/526 of query aligns to 57:535/716 of P24481
- S203 (= S157) modified: 2,3-didehydroalanine (Ser); mutation to A: Complete loss of activity.
- S210 (= S164) mutation to A: No loss of activity.
B2J528 Phenylalanine ammonia-lyase; EC 4.3.1.24 from Nostoc punctiforme (strain ATCC 29133 / PCC 73102) (see paper)
32% identity, 88% coverage: 8:472/526 of query aligns to 19:495/569 of B2J528
- A167 (= A156) modified: Crosslink with 169, 5-imidazolinone (Ala-Gly)
- S168 (= S157) modified: 2,3-didehydroalanine (Ser)
- G169 (= G158) modified: Crosslink with 167, 5-imidazolinone (Ala-Gly)
2o7eA Tyrosine ammonia-lyase from rhodobacter sphaeroides (his89phe variant), bound to 2-aminoindan-2-phosphonic acid (see paper)
36% identity, 83% coverage: 42:477/526 of query aligns to 29:476/515 of 2o7eA
- active site: Y54 (= Y67), G61 (= G74), L84 (≠ H97), N195 (= N209), Y292 (= Y290), R295 (= R293), F342 (= F339), Q428 (= Q429)
- binding (2-amino-2,3-dihydro-1h-inden-2-yl)phosphonic acid: Y54 (= Y67), G143 (= G158), L145 (= L160), N195 (= N209), Y292 (= Y290), R295 (= R293), N325 (= N323), F342 (= F339)
4c5sC Structural investigations into the stereochemistry and activity of a phenylalanine-2,3-aminomutase from taxus chinensis (see paper)
35% identity, 86% coverage: 18:467/526 of query aligns to 23:479/642 of 4c5sC
- active site: A71 (≠ Y67), G78 (= G74), L99 (≠ G100), N213 (= N209), Y304 (= Y290), R307 (= R293), F353 (= F339), Q441 (= Q429)
- binding (3S)-3-amino-2,2-difluoro-3-phenylpropanoic acid: G78 (= G74), G159 (= G158), L161 (= L160), N213 (= N209), Y304 (= Y290), R307 (= R293), N337 (= N323), F353 (= F339), E437 (= E425)
2o7dA Tyrosine ammonia-lyase from rhodobacter sphaeroides, complexed with caffeate (see paper)
36% identity, 83% coverage: 42:477/526 of query aligns to 29:476/515 of 2o7dA
- active site: Y54 (= Y67), G61 (= G74), L84 (≠ H97), N195 (= N209), Y292 (= Y290), R295 (= R293), F342 (= F339), Q428 (= Q429)
- binding caffeic acid: G61 (= G74), H83 (≠ Y96), L84 (≠ H97), Y292 (= Y290), R295 (= R293), N424 (≠ E425), N427 (= N428), Q428 (= Q429)
6hqfA Structure of phenylalanine ammonia-lyase from petroselinum crispum in complex with (r)-apep
32% identity, 88% coverage: 15:476/526 of query aligns to 33:497/673 of 6hqfA
- active site: Y86 (= Y67), G93 (= G74), Y313 (= Y290), F362 (= F339)
- binding [(1R)-1-amino-2-phenylethyl]phosphonic acid: Y86 (= Y67), F92 (≠ Y73), G178 (= G158), L180 (= L160), N234 (= N209), N346 (= N323), F362 (= F339), E446 (= E425)
6f6tB Phenylalanine ammonia-lyase (pal) from petroselinum crispum complexed with s-appa
32% identity, 88% coverage: 15:476/526 of query aligns to 34:498/677 of 6f6tB
Q0VZ68 Tyrosine 2,3-aminomutase; Tyrosine ammonia-lyase; EC 5.4.3.6; EC 4.3.1.23 from Chondromyces crocatus (see paper)
36% identity, 77% coverage: 66:470/526 of query aligns to 50:473/531 of Q0VZ68
- F57 (≠ Y73) mutation to Y: Loss of aminomutase activity.
- LVPVMI 60:65 (≠ SCTVTV 76:81) mutation to MIYMLV: Shift towards ammonia lyase activity.
- RSHA 79:82 (≠ TYHG 95:98) mutation to TFLS: Total loss of aminomutase activity.
- RSHAA 79:83 (≠ TYHGC 95:99) mutation to YHLAT: Total loss of aminomutase activity.
- G184 (≠ R200) mutation to R: Gain of aminomutase activity.
- K242 (= K258) mutation to R: Gain of aminomutase activity.
- 275:288 (vs. gap) mutation Missing: Total loss of aminomutase activity.
- P377 (≠ Q372) mutation to R: No effect.
- C396 (≠ H394) mutation to S: No effect.
- E399 (≠ K397) mutation to A: Loss of aminomutase activity and increased product racemization. Gain of ammonia-lyase activity.; mutation to K: Loss of aminomutase and ammonia-lyase activity. Higher enantiomeric excess of (R)-beta-tyrosine.; mutation to M: Loss of aminomutase and ammonia-lyase activity.
- 399:406 (vs. 397:404, 25% identical) mutation to MIAQVTSA: Residual aminomutase activity.
- 427:433 (vs. 425:431, 43% identical) mutation to SAGREDH: Total loss of aminomutase activity.; mutation to SANQEDH: Total loss of aminomutase activity.
Q3M5Z3 Phenylalanine ammonia-lyase; EC 4.3.1.24 from Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) (see 2 papers)
33% identity, 88% coverage: 11:471/526 of query aligns to 22:494/567 of Q3M5Z3
- L108 (≠ H97) mutation to A: Slightly decreases catalytic rate.; mutation to G: Decreases catalytic rate.
- A167 (= A156) modified: Crosslink with 169, 5-imidazolinone (Ala-Gly)
- S168 (= S157) modified: 2,3-didehydroalanine (Ser)
- G169 (= G158) modified: Crosslink with 167, 5-imidazolinone (Ala-Gly)
Sites not aligning to the query:
- 1:21 mutation Missing: No effect on enzyme activity.
- 503 C→S: Prevents formation of artifactual disulfide bonds and increases solubility; when associated with S-565.
- 565 C→S: Prevents formation of artifactual disulfide bonds and increases solubility; when associated with S-503.
Query Sequence
>HSERO_RS18505 FitnessBrowser__HerbieS:HSERO_RS18505
MPHTDLTSSASSTPIRFGAQPLAIEDVVALARRERSAQLHDAPDFRARIARGADFLDRLL
REDGTIYGVTTGYGDSCTVTVPPELVPELPHHLYTYHGCGLGALFTPEQARAILAARLNS
LCQGFSGVSVALLEQITGLLQHDLLPQIPCEGSVGASGDLTPLSYLAAVLCGERDVWREG
ATVPAAQALAAAGMTPLRLRPKEGLAIMNGTAVMTALACLAFDRARYLCQLATRITAMSS
FTLDGNAHHFDATLFSAKPHPGQQQVAAWLQRDLPCGQAHRNEKRLQDRYSVRCAPHVIG
VLNDALPSLRQFIENELNSANDNPLIDPDGERVLHGGHFYGGHIAFAMDSMKTAVANVAD
LLDRQMALMVDQRYNNGLPANLSGAQGARAPINHGLKALQISASAWTAEALKLTMPASVF
SRSTECHNQDKVSMGTIAARDCLRVLELTEQVAAALLITVRQGVWLRSQRQQVGDTPLQD
LPAGRLAAMQAALSEDIAVVAEDRMLEPDLRLLLQRIRAQAWSLYD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory