SitesBLAST
Comparing HSERO_RS18760 FitnessBrowser__HerbieS:HSERO_RS18760 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
48% identity, 84% coverage: 53:469/499 of query aligns to 1:402/418 of 7w2jC
- binding heme c: C13 (= C65), C16 (= C68), H17 (= H69), T42 (= T93), I44 (= I95), Y55 (= Y106), L75 (= L126), Y76 (= Y127), A78 (= A129), M79 (= M130), R122 (= R173), H161 (= H211), C162 (= C212), C165 (= C215), H166 (= H216), A191 (= A241), P192 (= P242), R223 (≠ Q274), P227 (≠ S278), M228 (= M279), V289 (≠ S354), C290 (= C355), C293 (= C358), H294 (= H359), Y305 (= Y370), Y306 (= Y371), P307 (= P372), L309 (= L374), N312 (= N377), T313 (≠ S378), T314 (≠ A379), D322 (≠ N387), I327 (= I392), V331 (= V396), R333 (= R398), I340 (≠ V406), M342 (= M408), P343 (= P409), F345 (= F411)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
48% identity, 83% coverage: 53:465/499 of query aligns to 1:412/413 of 8jejC
- binding heme c: C13 (= C65), C16 (= C68), H17 (= H69), T42 (= T93), I44 (= I95), F60 (= F111), L64 (= L115), L75 (= L126), Y76 (= Y127), M79 (= M130), P80 (= P131), Y84 (= Y135), R122 (= R173), C162 (= C212), C165 (= C215), H166 (= H216), I186 (≠ V236), W189 (= W239), A191 (= A241), P192 (= P242), I194 (= I244), W205 (= W255), Y213 (= Y263), R223 (≠ Q274), M228 (= M279), V303 (≠ S354), C304 (= C355), C307 (= C358), H308 (= H359), Y320 (= Y371), P321 (= P372), L323 (= L374), T327 (≠ S378), T328 (≠ A379), D336 (≠ N387), I341 (= I392), V345 (= V396), R347 (= R398), I354 (≠ V406), M356 (= M408), F359 (= F411), I376 (≠ L429)
- binding ubiquinone-10: M36 (≠ V87), P77 (= P128), S124 (= S175), W128 (= W179), C165 (= C215), L173 (≠ M223), L408 (= L461), L411 (≠ M464)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
38% identity, 82% coverage: 49:456/499 of query aligns to 40:437/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
38% identity, 82% coverage: 49:456/499 of query aligns to 2:399/433 of 8gy2B
- binding heme c: C18 (= C65), C21 (= C68), H22 (= H69), T46 (= T93), I48 (= I95), Y59 (= Y106), L68 (= L115), R73 (= R120), V79 (≠ L126), Y80 (= Y127), M83 (= M130), F88 (≠ Y135), R126 (= R173), H165 (= H211), C166 (= C212), C169 (= C215), H170 (= H216), I201 (≠ Y240), A202 (= A241), P203 (= P242), L205 (≠ I244), W216 (= W255), F224 (≠ Y263), A234 (= A273), V235 (≠ A275), F236 (≠ A276), F236 (≠ A276), M239 (= M279), N301 (≠ S354), C302 (= C355), C305 (= C358), H306 (= H359), M316 (≠ Y370), F317 (≠ Y371), P318 (= P372), L320 (= L374), P324 (≠ S378), G342 (≠ V406), S352 (≠ N416), V354 (≠ L418), M356 (vs. gap), F359 (vs. gap), M375 (≠ L433)
- binding ubiquinone-10: C21 (= C68), L34 (= L81), P39 (= P86), P81 (= P128), L129 (≠ M176), W132 (= W179), E168 (≠ T214), R173 (= R219), I197 (≠ V236), D241 (≠ E281)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
37% identity, 80% coverage: 37:435/499 of query aligns to 24:409/440 of 8gy3A
- binding heme c: Y52 (≠ D64), C53 (= C65), C56 (= C68), H57 (= H69), S84 (≠ T93), I86 (= I95), W97 (≠ Y106), F102 (= F111), L117 (= L126), F121 (≠ M130), F126 (≠ Y135), R163 (= R173), C203 (= C212), C206 (= C215), H207 (= H216), A232 (= A241), P233 (= P242), L235 (≠ I244), W245 (= W255), Y253 (= Y263), L254 (= L264), G263 (≠ A273), S264 (≠ Q274), M269 (= M279), Y292 (≠ I302), C337 (= C355), C340 (= C358), H341 (= H359), P353 (= P372), L355 (= L374), N358 (= N377), N359 (≠ S378), V372 (≠ T391), I377 (≠ V396), G382 (≠ E401), Q383 (= Q402), I386 (≠ V406), M388 (= M408), F391 (= F411)
- binding ubiquinone-10: E55 (≠ A67), T76 (≠ S85), F78 (≠ V87), Y118 (= Y127), P119 (= P128), I160 (≠ M170), G166 (≠ M176), Q167 (≠ K177), F169 (vs. gap), W170 (= W179), H202 (= H211), R210 (= R219), L213 (= L222)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
39% identity, 25% coverage: 331:453/499 of query aligns to 9:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C355), C33 (= C358), H34 (= H359), Y46 (= Y371), P47 (= P372), T54 (≠ A379), V66 (≠ T391), I67 (= I392), R73 (= R398), I80 (≠ V406), M82 (= M408), P83 (= P409)
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
27% identity, 21% coverage: 347:453/499 of query aligns to 352:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ S354), C360 (= C355), C363 (= C358), H364 (= H359), P376 (= P372), P377 (≠ S373), L378 (= L374), F383 (≠ A379), N400 (≠ D397), G401 (≠ R398), Y410 (≠ F407), S412 (vs. gap), M414 (= M408), M417 (≠ L418)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
27% identity, 21% coverage: 347:453/499 of query aligns to 353:453/456 of 5oboA
- binding heme c: T360 (≠ S354), C361 (= C355), C364 (= C358), H365 (= H359), P377 (= P372), P378 (≠ S373), L379 (= L374), S382 (≠ N377), F384 (≠ A379), I395 (≠ T391), N401 (≠ D397), G402 (≠ R398), S413 (vs. gap), M415 (= M408), M418 (≠ L418)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
27% identity, 21% coverage: 347:453/499 of query aligns to 355:455/457 of 4ax3D
- binding heme c: C363 (= C355), C366 (= C358), H367 (= H359), P379 (= P372), P380 (≠ S373), L381 (= L374), S384 (≠ N377), F386 (≠ A379), N403 (≠ D397), G404 (≠ R398), S415 (vs. gap), M417 (= M408), M420 (≠ L418)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
Query Sequence
>HSERO_RS18760 FitnessBrowser__HerbieS:HSERO_RS18760
MHKTLLTVLLAALMAGSALAQTTDSNTTPSADATASAAAPAPAPAISPEAALIERGHYLA
IASDCIACHTAPRGKPMAGGLAIASPVGEIIATNITPSKTHGIGNYTEEQFAAALRRGVR
ADGANLYPAMPYTAYAALSDADVQALYAYFMKGVAPVDVATRPTDLPFPMNLRWSMKAWN
ALFLKEQPLPPQPQRSAQWLRGRYLAEGPAHCSTCHTPRGWLMQEKPDLQLAGAQVGPWY
APNITSHPSAGIGSWSQDDLVAYLRTGRLEGRAQAAGSMAEAITHSFSRLTEEDLRAIAV
YIKDRPAIATGDAQGSGSRFDQGKAGNALAQFRGRTLSAESPEEIRGARIFSASCASCHG
YNGQGSRDGYYPSLFRNSATAGVNANNLIATILYGVDRETEQGGHVFMPPFGDQPNALNK
LSNADVAALSNYLLKYYGKPAATVKAEDVEVIRQGGPRSPLLLMARIGMGVAVAVLVLLL
LVGLMVALRKRPDPEHDWK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory