SitesBLAST
Comparing HSERO_RS19090 FitnessBrowser__HerbieS:HSERO_RS19090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
34% identity, 93% coverage: 6:406/431 of query aligns to 11:419/425 of O59010
- S65 (≠ T63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 269:271) binding
- M311 (≠ L304) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S307) binding
- V355 (= V348) binding
- D394 (= D381) binding
- M395 (= M382) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R384) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N388) binding
- D405 (≠ N392) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
34% identity, 92% coverage: 6:403/431 of query aligns to 2:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
34% identity, 93% coverage: 6:406/431 of query aligns to 11:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ A44), F46 (≠ A44), P75 (≠ D73), L91 (≠ I90), F95 (≠ V94), L130 (vs. gap), I133 (vs. gap), I159 (≠ M160), Y167 (≠ S168), K196 (= K189), G200 (≠ Y193), I207 (≠ V200), F210 (= F203), L250 (≠ F246), I262 (= I258), M269 (≠ F262), T334 (≠ P327), V335 (≠ I328), G336 (≠ S329), T340 (= T333), L343 (= L336), M399 (≠ A386)
- binding aspartic acid: S277 (= S270), S278 (= S271), T314 (≠ S307), G354 (= G347), A358 (= A351), G359 (≠ S352), D394 (= D381), R397 (= R384), T398 (≠ S385)
- binding sodium ion: Y89 (≠ F88), T92 (≠ A91), S93 (= S92), G306 (= G299), T308 (≠ S301), N310 (= N303), N310 (= N303), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), T352 (≠ I345), N401 (= N388), V402 (≠ A389), D405 (≠ N392)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
34% identity, 93% coverage: 6:404/431 of query aligns to 3:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
33% identity, 92% coverage: 6:403/431 of query aligns to 8:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ L85), I157 (≠ F161), Y164 (≠ S168), K193 (= K189), T305 (≠ S301), I306 (≠ F302), I347 (≠ K343)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I11), M199 (= M195), S275 (= S271), T311 (≠ S307), G356 (≠ S352), L384 (= L374), D391 (= D381), R394 (= R384)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 92% coverage: 6:403/431 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S271), M303 (≠ L304), T306 (≠ S307), A345 (= A346), G346 (= G347), V347 (= V348), G351 (≠ S352), D386 (= D381), C389 (≠ R384), T390 (≠ S385), N393 (= N388)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
32% identity, 92% coverage: 6:403/431 of query aligns to 3:396/396 of 6bmiA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
33% identity, 91% coverage: 11:403/431 of query aligns to 7:405/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A269), S265 (= S271), M299 (≠ L304), T302 (≠ S307), T340 (≠ I345), G342 (= G347), V343 (= V348), G347 (≠ S352), D383 (= D381), R386 (= R384), T387 (≠ S385), N390 (= N388)
- binding decyl-beta-d-maltopyranoside: H23 (= H28), V212 (≠ L218), A216 (= A222)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
33% identity, 91% coverage: 11:403/431 of query aligns to 11:413/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K189), G195 (≠ Y193), R282 (≠ D280)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A269), S272 (= S270), S273 (= S271), M307 (≠ L304), T310 (≠ S307), G353 (≠ R350), A354 (= A351), R394 (= R384), T395 (≠ S385)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
33% identity, 91% coverage: 11:403/431 of query aligns to 12:414/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
33% identity, 91% coverage: 11:403/431 of query aligns to 14:416/427 of 5e9sA
- binding aspartic acid: R274 (≠ A269), S275 (= S270), S276 (= S271), T313 (≠ S307), G353 (= G347), V354 (= V348), A357 (= A351), G358 (≠ S352), D394 (= D381), R397 (= R384), T398 (≠ S385)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K189), G198 (≠ Y193), Y202 (≠ F197)
- binding sodium ion: Y87 (≠ F88), T90 (≠ A91), S91 (= S92), S276 (= S271), G305 (= G299), A306 (≠ Y300), T307 (≠ S301), N309 (= N303), N309 (= N303), M310 (≠ L304), D311 (= D305), S348 (= S342), I349 (≠ K343), G350 (= G344), T351 (≠ I345), N401 (= N388), V402 (≠ A389), D405 (≠ N392)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
33% identity, 91% coverage: 11:403/431 of query aligns to 14:416/426 of 6xwnB
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 94% coverage: 18:424/431 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V77), G89 (= G78), G92 (≠ F81), A95 (≠ S84), V96 (≠ L85), Y99 (≠ F88), M163 (= M160), F167 (≠ I164), F293 (= F294), V297 (≠ M298)
- binding aspartic acid: S268 (= S270), S269 (= S271), T306 (≠ S307), G346 (= G347), I347 (≠ V348), A350 (= A351), G351 (≠ S352), D380 (= D381), R383 (= R384), T384 (≠ S385)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 94% coverage: 18:423/431 of query aligns to 25:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I68), S80 (≠ V77), G81 (= G78), G84 (≠ F81), Y91 (≠ F88), M156 (= M160), F160 (≠ I164), F286 (= F294), V290 (≠ M298)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V60), I148 (≠ V152), S262 (= S271), S263 (≠ E272), A292 (≠ Y300), T293 (≠ S301), M296 (≠ L304), T299 (≠ S307), G329 (= G344), A336 (= A351), G337 (≠ S352), D366 (= D381), R369 (= R384), N373 (= N388)
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
27% identity, 91% coverage: 40:430/431 of query aligns to 74:505/532 of P43007
- N201 (= N150) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ H185) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ M382) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
27% identity, 90% coverage: 13:401/431 of query aligns to 13:421/433 of 8cv2A
- binding sodium ion: Y85 (≠ F88), T88 (≠ A91), T89 (≠ S92), G319 (= G299), A320 (≠ Y300), N323 (= N303), N323 (= N303), M324 (≠ L304), D325 (= D305), N408 (= N388), D412 (≠ N392)
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
26% identity, 90% coverage: 13:401/431 of query aligns to 10:400/406 of 8ctcA
- binding glutamic acid: S268 (= S270), S269 (= S271), M303 (≠ L304), T306 (≠ S307), G346 (= G347), A350 (= A351), D380 (= D381), R383 (= R384)
- binding sodium ion: Y82 (≠ F88), T85 (≠ A91), T86 (≠ S92), S269 (= S271), G298 (= G299), A299 (≠ Y300), T300 (≠ S301), N302 (= N303), N302 (= N303), M303 (≠ L304), D304 (= D305), S341 (= S342), I342 (≠ K343), G343 (= G344), A344 (≠ I345), N387 (= N388), D391 (≠ N392)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
26% identity, 90% coverage: 13:401/431 of query aligns to 13:403/416 of 8cuaA
6x2zA Heaat3-ofs-asp (see paper)
26% identity, 90% coverage: 13:401/431 of query aligns to 11:408/419 of 6x2zA
- binding aspartic acid: S275 (≠ A269), S277 (= S271), T314 (≠ S307), G354 (= G347), V355 (= V348), D388 (= D381), R391 (= R384), T392 (≠ S385)
- binding sodium ion: Y83 (≠ F88), T86 (≠ A91), T87 (≠ S92), G306 (= G299), A307 (≠ Y300), T308 (≠ S301), I309 (≠ F302), N310 (= N303), N310 (= N303), M311 (≠ L304), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), G351 (= G344), A352 (≠ I345), N395 (= N388), D399 (≠ N392)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
25% identity, 83% coverage: 41:399/431 of query aligns to 43:410/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S270), S281 (= S271), T318 (≠ S307), G363 (≠ S352), M367 (≠ I356), V385 (≠ L374), D388 (= D377), R395 (= R384), T396 (≠ S385)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ T378)
- binding cholesterol hemisuccinate: R80 (= R79), R84 (≠ K83), I95 (≠ V94), I252 (≠ V242)
Sites not aligning to the query:
Query Sequence
>HSERO_RS19090 FitnessBrowser__HerbieS:HSERO_RS19090
MKKRIPQAAYIFAAMLLGILVGYLIFSHNDKAQAKELAGYISIASDLFLRLIKMVIAPLV
FSTLVVGIAHMGDAKSVGRIFGKSLAWFFIASLVSLALGMIMANLLQPGAGVALPSPDAA
GAGLATSKFTVKEFFNHLVPKSIVEAMAQNEVLQVVVFSMFFGIALASLGERGKHLLAVI
DDLSHTMLKITVYVMKFAPVAVFAAMAATVAVNGLEILVSFAVFMRDFYFSLVLLWVILI
AVGFIFLKKRIFHLLALIKEAFLLAFATASSEAAYPKLLDALDRFGVKRKISSFVMPMGY
SFNLDGSMIYCTFATLFIAQAYGIHMPISTQITMMLVLMLTSKGIAGVPRASLVVIAATL
HQFNIPEAGLLVILGIDTFLDMGRSATNAVGNSIASAVVAKWEGGLMTEEEAARAEVEIE
QEAEAKLHTEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory