SitesBLAST
Comparing HSERO_RS19095 FitnessBrowser__HerbieS:HSERO_RS19095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5odqB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
25% identity, 58% coverage: 171:410/414 of query aligns to 5:268/291 of 5odqB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), C41 (= C207), C42 (= C208), C78 (≠ A251), G80 (= G253), C81 (= C254), G152 (≠ A309), C153 (≠ Y310), H154 (= H311), C193 (= C346), C194 (= C347), C231 (≠ G386), F233 (≠ V388), C234 (≠ T389)
- binding 2-bromanylethanesulfonic acid: G46 (≠ I211), G80 (= G253), H154 (= H311), G197 (≠ A350), R201 (≠ S354), F233 (≠ V388), L236 (= L391)
5odhH Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
25% identity, 58% coverage: 171:410/414 of query aligns to 5:268/291 of 5odhH
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), C41 (= C207), C42 (= C208), C78 (≠ A251), G80 (= G253), C81 (= C254), C153 (≠ Y310), H154 (= H311), C193 (= C346), C194 (= C347), C231 (≠ G386), F233 (≠ V388), C234 (≠ T389)
- binding 1-thioethanesulfonic acid: A44 (= A210), P45 (vs. gap), G46 (≠ I211), G80 (= G253), H154 (= H311), G197 (≠ A350), G198 (= G351)
- binding Coenzyme B: R201 (≠ S354), F233 (≠ V388), R240 (vs. gap)
5odhB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
25% identity, 58% coverage: 171:410/414 of query aligns to 5:268/291 of 5odhB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), I10 (≠ V176), C41 (= C207), C42 (= C208), C78 (≠ A251), G80 (= G253), C81 (= C254), G152 (≠ A309), C153 (≠ Y310), H154 (= H311), C193 (= C346), C194 (= C347), C231 (≠ G386), F233 (≠ V388), C234 (≠ T389)
- binding 1-thioethanesulfonic acid: P45 (vs. gap), G46 (≠ I211), G80 (= G253), F233 (≠ V388)
5odcB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
25% identity, 58% coverage: 171:410/414 of query aligns to 5:268/291 of 5odcB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), I10 (≠ V176), C41 (= C207), C42 (= C208), C78 (≠ A251), N79 (≠ S252), G80 (= G253), C81 (= C254), G152 (≠ A309), C153 (≠ Y310), C193 (= C346), C194 (= C347), G197 (≠ A350), C231 (≠ G386), F233 (≠ V388), C234 (≠ T389)
6myqB Avian mitochondrial complex ii with ferulenol bound (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 6myqB
- binding 4-oxidanyl-3-[(2~{E},6~{E})-3,7,11-trimethyldodeca-2,6,10-trienyl]chromen-2-one: W165 (≠ L40), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86)
Sites not aligning to the query:
1yq3B Avian respiratory complex ii with oxaloacetate and ubiquinone (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 137:237/242 of 1yq3B
- binding fe3-s4 cluster: C163 (= C35), Y173 (≠ L45), P176 (= P48), C210 (= C75), T212 (= T77), I213 (≠ C78), M214 (≠ R79), N215 (= N80), C216 (= C81)
- binding iron/sulfur cluster: C153 (= C25), I154 (≠ V26), L155 (≠ H27), C156 (= C28), A157 (≠ G29), C159 (= C31), A177 (vs. gap), C220 (= C85), P221 (= P86)
- binding Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer: P164 (= P36), W168 (≠ L40), I213 (≠ C78)
Sites not aligning to the query:
6mysB Avian mitochondrial complex ii with atpenin a5 bound, sidechain outside (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 135:235/240 of 6mysB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (vs. gap), C218 (= C85)
Sites not aligning to the query:
6myrB Avian mitochondrial complex ii with thiapronil bound (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 135:235/240 of 6myrB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), H209 (≠ L76), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding thiapronil: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (vs. gap), C218 (= C85)
Sites not aligning to the query:
6mypB Avian mitochondrial complex ii with ttfa (thenoyltrifluoroacetone) bound (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 135:235/240 of 6mypB
- binding fe3-s4 cluster: C161 (= C35), C208 (= C75), H209 (≠ L76), T210 (= T77), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (vs. gap), C218 (= C85)
- binding 4,4,4-trifluoro-1-thien-2-ylbutane-1,3-dione: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
Sites not aligning to the query:
6myoB Avian mitochondrial complex ii with flutolanyl bound (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 135:235/240 of 6myoB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (vs. gap), C218 (= C85)
Sites not aligning to the query:
2fbwB Avian respiratory complex ii with carboxin bound (see paper)
28% identity, 23% coverage: 8:102/414 of query aligns to 135:235/240 of 2fbwB
- binding 2-methyl-n-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), C157 (= C31), A175 (vs. gap), C218 (= C85), P219 (= P86)
Sites not aligning to the query:
3sfdB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol (see paper)
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3sfdB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding pentachlorophenol: P161 (= P36), W165 (≠ L40), I210 (≠ C78)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86), K219 (≠ S87)
Sites not aligning to the query:
3aegB Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3aegB
- binding N-biphenyl-3-yl-2-iodobenzamide: S162 (≠ T37), W164 (≠ Q39), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), C213 (= C81), I227 (≠ V95)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (vs. gap), C217 (= C85)
Sites not aligning to the query:
3aeeB Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3aeeB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3aedB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3aedB
- binding 2-iodo-N-phenylbenzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3aecB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3aecB
- binding 2-iodo-N-(1-methylethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3aebB Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3aebB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding N-(3-phenoxyphenyl)-2-(trifluoromethyl)benzamide: W165 (≠ L40), H208 (≠ L76)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (vs. gap), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3aeaB Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-dimethylaminomethyl-phenyl)-2-trifluoromethyl-benzamide (see paper)
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3aeaB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding N-{3-[(dimethylamino)methyl]phenyl}-2-(trifluoromethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3ae9B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-pentafluorophenyloxy-phenyl)-2-trifluoromethyl-benzamide (see paper)
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3ae9B
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), H208 (≠ L76), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding N-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (vs. gap), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3ae8B Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-isopropoxy-phenyl)-2-trifluoromethylbenzamide
27% identity, 23% coverage: 8:102/414 of query aligns to 134:234/239 of 3ae8B
- binding fe3-s4 cluster: C160 (= C35), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), C213 (= C81)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: S162 (≠ T37), W165 (≠ L40), H208 (≠ L76)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (vs. gap), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
Query Sequence
>HSERO_RS19095 FitnessBrowser__HerbieS:HSERO_RS19095
MQTNLADFIRNTQAGQEADSILRSCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQVLE
GKPATAATQSHLDRCLTCRNCESTCPSGVQYGRLVDIGRKVVEEQVPRPLSQRVMRTALK
ELVPRKWIFRPAMKAGQMLRPLLPKLLQNKVPLPQEAGAWPTRTHARQMLYLEGCVQPSM
SPNINSATARVLDALGVQLFAPPKAGCCGAIRYHMNDQEGGLEDMRRNIDAWWPYIEGRD
GIRADTIVMNASGCGSTVKEYGHLLQHDPVYAEKARRISHMTRDISEILPEFEEALKHKL
KDFNGKRVAYHPPCTLQHGQKIRGKVEGILRAAGVDVQLCADSHLCCGSAGTYSILQPEL
SYRLRDNKISKLQATDPDMIVTGNIGCVTHLQSGTDTPVRHWIELLDAALQAPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory