SitesBLAST
Comparing HSERO_RS19100 FitnessBrowser__HerbieS:HSERO_RS19100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 42% coverage: 25:175/359 of query aligns to 70:220/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I28), G75 (= G30), S76 (≠ G31), G77 (= G32), T78 (= T33), G79 (≠ K34), L80 (≠ D35), A83 (≠ G38), C84 (≠ Q39), P137 (≠ F93), G138 (= G94), E139 (vs. gap), A142 (= A97), T143 (= T98), G146 (= G101), N147 (≠ M102), S149 (≠ A104), T150 (≠ A105), A152 (≠ L107), G153 (≠ S108), E203 (≠ L158), G204 (= G159), I209 (= I164)
Sites not aligning to the query:
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 48% coverage: 29:200/359 of query aligns to 70:243/465 of 3pm9A
- active site: A149 (≠ L107), L159 (≠ A117)
- binding flavin-adenine dinucleotide: Q70 (≠ R29), G71 (= G30), G72 (= G31), N73 (≠ G32), T74 (= T33), G75 (≠ K34), L76 (≠ D35), G79 (= G38), Q80 (= Q39), L91 (≠ T48), L133 (≠ F93), G134 (= G94), A135 (vs. gap), C139 (≠ A97), T140 (= T98), G142 (= G100), G143 (= G101), S146 (≠ A104), T147 (≠ A105), A149 (≠ L107), G150 (≠ S108), E200 (≠ L158), G201 (= G159), I205 (≠ L163), I206 (= I164)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
27% identity, 49% coverage: 1:177/359 of query aligns to 52:226/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P25), G78 (= G30), G79 (= G31), N80 (≠ G32), T81 (= T33), G82 (≠ K34), M83 (≠ D35), G86 (= G38), S87 (≠ Q39), L140 (≠ F93), A142 (vs. gap), C146 (≠ A97), H147 (≠ T98), G150 (= G101), N151 (≠ M102), A153 (= A104), T154 (≠ A105), G208 (= G159), I212 (≠ L163), I213 (= I164)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
27% identity, 49% coverage: 1:177/359 of query aligns to 51:225/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (= P25), Q76 (≠ R29), G77 (= G30), G78 (= G31), N79 (≠ G32), T80 (= T33), G81 (≠ K34), M82 (≠ D35), G85 (= G38), S86 (≠ Q39), L139 (≠ F93), G140 (= G94), A141 (vs. gap), C145 (≠ A97), G149 (= G101), N150 (≠ M102), A152 (= A104), T153 (≠ A105), G157 (= G109), G207 (= G159), I212 (= I164)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
27% identity, 49% coverage: 1:177/359 of query aligns to 51:225/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P25), G77 (= G30), G78 (= G31), N79 (≠ G32), T80 (= T33), G81 (≠ K34), G85 (= G38), S86 (≠ Q39), L139 (≠ F93), G140 (= G94), A141 (vs. gap), C145 (≠ A97), H146 (≠ T98), G148 (= G100), G149 (= G101), N150 (≠ M102), A152 (= A104), T153 (≠ A105), A155 (≠ L107), E206 (≠ L158), G207 (= G159), I211 (≠ L163), I212 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
27% identity, 49% coverage: 1:177/359 of query aligns to 51:225/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (= P25), G77 (= G30), G78 (= G31), N79 (≠ G32), T80 (= T33), G81 (≠ K34), G85 (= G38), S86 (≠ Q39), L139 (≠ F93), G140 (= G94), A141 (vs. gap), C145 (≠ A97), H146 (≠ T98), G149 (= G101), N150 (≠ M102), A152 (= A104), T153 (≠ A105), A155 (≠ L107), G157 (= G109), E206 (≠ L158), G207 (= G159), I211 (≠ L163), I212 (= I164)
- binding d-malate: M82 (≠ D35)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
27% identity, 49% coverage: 1:177/359 of query aligns to 51:225/466 of 6lppA
- binding flavin-adenine dinucleotide: P75 (= P25), G77 (= G30), G78 (= G31), N79 (≠ G32), T80 (= T33), G81 (≠ K34), M82 (≠ D35), G85 (= G38), S86 (≠ Q39), L139 (≠ F93), G140 (= G94), A141 (vs. gap), C145 (≠ A97), G149 (= G101), N150 (≠ M102), A152 (= A104), T153 (≠ A105), A155 (≠ L107), G157 (= G109), G207 (= G159), I212 (= I164)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 422, 423
- binding zinc ion: 381, 388, 422
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
27% identity, 49% coverage: 1:177/359 of query aligns to 104:278/521 of Q8N465
- S109 (≠ Q6) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ R24) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G31) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L45) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ Y51) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T70) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P90) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A104) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A130) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G132) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 42% coverage: 23:174/359 of query aligns to 63:214/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdrA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 324, 370, 414, 451
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: 319, 323, 415
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdqA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding (2R)-2-hydroxy-4-methylpentanoic acid: 319, 323, 370, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 370, 414, 451
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdoA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding (2R)-2-hydroxyhexanoic acid: 319, 323, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 324, 370, 414, 451
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdnA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 370, 414, 451
- binding (2R)-2-oxidanylpentanoic acid: 319, 323, 415
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdgA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 370, 414, 451
- binding (2R)-2-oxidanylbutanoic acid: 319, 415
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdbA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 324, 370, 414, 451
- binding (2R)-2-oxidanyloctanoic acid: 75, 319, 323, 415
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/456 of 8jdsA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 323, 414, 415, 451
- binding manganese (ii) ion: 370, 377, 414
- binding pyruvic acid: 319, 370, 377, 415
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/455 of 8jdeA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 413, 414, 450
- binding lactic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/454 of 8jdzA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding (3S)-3-methyl-2-oxopentanoic acid: 318, 322, 369, 376, 413
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 412, 413, 449
- binding manganese (ii) ion: 369, 376, 412
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/454 of 8jdyA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding 2-oxo-4-methylpentanoic acid: 318, 322, 336, 369, 376, 413
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 412, 449
- binding manganese (ii) ion: 369, 376, 412
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
36% identity, 25% coverage: 88:178/359 of query aligns to 127:220/455 of 8jdtA
- binding flavin-adenine dinucleotide: P132 (≠ F93), G133 (= G94), A134 (≠ G95), G140 (= G101), M141 (= M102), A143 (= A104), T144 (≠ A105), A146 (≠ L107), S147 (= S108), E200 (≠ L158), G201 (= G159), I206 (= I164)
Sites not aligning to the query:
- binding 2-ketobutyric acid: 318, 369, 376, 414
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 413, 414, 450
- binding manganese (ii) ion: 369, 376, 413
Query Sequence
>HSERO_RS19100 FitnessBrowser__HerbieS:HSERO_RS19100
MQEQAQQDLDAVLASFRERILAGRPLQIRGGGTKDWYGQTPSGELLDTRAYSGIIDYEPT
ELVITARCGTPLSEIDAALAQHNQMLAWEPPSFGGAATVGGMVAAGLSGPARASAGAVRD
FVLGAVLMDAQGEPLHFGGQVMKNVAGYDISRLLAGSLGTLGLILEVSLKVLPRPIASST
RVFEINQEGALRLLNQSAGQPLPLVASAWVGNVLTIRLSGAQAAVDSAIAKLGGTELSNP
DDYWTDLREQTHPFFADAEAPLWRLSLPSVAAPIDLPGRQLIEWGGAQRWLRPEGNVDAV
TIRAAALAVGGHASLHRGGDKAIGVFHPLQPAVETLHRRLKQQFDPQGIFNPGRLYASL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory