SitesBLAST
Comparing HSERO_RS19105 FitnessBrowser__HerbieS:HSERO_RS19105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
28% identity, 91% coverage: 18:466/495 of query aligns to 11:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P80), G75 (= G82), S76 (≠ A83), G77 (= G84), T78 (= T85), G79 (= G86), L80 (= L87), A83 (≠ G90), C84 (≠ A91), P137 (= P144), G138 (≠ S145), E139 (≠ S146), A142 (= A149), T143 (≠ S151), G146 (= G154), N147 (= N155), S149 (≠ A157), T150 (≠ E158), A152 (≠ S160), G153 (= G161), E203 (= E210), G204 (= G211), I209 (≠ V216), E422 (= E426), H423 (= H427)
- binding fe (iii) ion: H377 (= H382), H384 (= H389), E422 (= E426)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 84% coverage: 50:464/495 of query aligns to 38:452/459 of P9WIT1
- K354 (≠ Q361) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F337), E413 (= E426), H414 (= H427), N450 (= N463)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H427)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F337), E413 (= E426), H414 (= H427), N450 (= N463)
- binding lactic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H427)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F337), E413 (= E426), H414 (= H427), N450 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W323 (≠ F337), E414 (= E426), H415 (= H427), N451 (= N463)
- binding manganese (ii) ion: H370 (= H382), H377 (= H389), E414 (= E426)
- binding pyruvic acid: R319 (= R333), H370 (= H382), H377 (= H389), H415 (= H427)
Sites not aligning to the query:
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R333), W322 (≠ F337), H369 (= H382), H376 (= H389), H413 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F337), E412 (= E426), H413 (= H427), N449 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E426)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R333), W322 (≠ F337), S336 (≠ C349), H369 (= H382), H376 (= H389), H413 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), E412 (= E426), N449 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E426)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R333), W322 (≠ F337), H369 (= H382), H376 (= H389), H414 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W322 (≠ F337), E413 (= E426), N450 (= N463)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E426)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 85% coverage: 50:468/495 of query aligns to 38:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L87), R317 (= R333), W321 (≠ F337), H368 (= H382), H375 (= H389), H413 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), W321 (≠ F337), Y322 (≠ P338), E412 (= E426), H413 (= H427), N449 (= N463)
- binding manganese (ii) ion: H368 (= H382), H375 (= H389), E412 (= E426)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H369 (= H382), E413 (= E426), N450 (= N463)
- binding deaminohydroxyvaline: R319 (= R333), H414 (= H427)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), Y324 (≠ P338), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R333), W323 (≠ F337), H415 (= H427)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R333), W323 (≠ F337), H370 (= H382), H415 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H370 (= H382), E414 (= E426), N451 (= N463)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R333), W323 (≠ F337), H415 (= H427)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), Y324 (≠ P338), H370 (= H382), E414 (= E426), N451 (= N463)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R333), W323 (≠ F337), H415 (= H427)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R333), H415 (= H427)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
29% identity, 85% coverage: 50:468/495 of query aligns to 38:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (= G86), G78 (= G90), V79 (≠ A91), L90 (≠ T102), P132 (= P144), G133 (≠ S145), A134 (≠ S146), G140 (= G154), M141 (≠ N155), A143 (= A157), T144 (≠ E158), A146 (≠ S160), S147 (≠ G161), E200 (= E210), G201 (= G211), I206 (≠ V216), Y324 (≠ P338), H370 (= H382), E414 (= E426), N451 (= N463)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L87), R319 (= R333), W323 (≠ F337), H415 (= H427)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
27% identity, 92% coverage: 14:470/495 of query aligns to 63:519/521 of Q8N465
- S109 (≠ E61) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V79) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A83) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V99) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F105) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V124) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A141) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A157) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ I183) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G185) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ E323) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R333) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F337) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ Y347) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ C349) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ E370) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ C377) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H382) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G384) to V: slight reduction in catalytic activity
- N439 (= N387) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H389) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N397) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I398) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ D400) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E426) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H427) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G428) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
27% identity, 92% coverage: 14:470/495 of query aligns to 11:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ G44), P76 (= P80), G78 (= G82), G79 (≠ A83), N80 (≠ G84), T81 (= T85), G82 (= G86), M83 (≠ L87), G86 (= G90), S87 (≠ A91), L140 (≠ P144), A142 (≠ S146), C146 (= C150), H147 (≠ S151), G150 (= G154), N151 (= N155), A153 (= A157), T154 (≠ E158), G208 (= G211), I212 (≠ V215), I213 (≠ V216), E423 (= E426), N460 (= N463)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
27% identity, 92% coverage: 14:470/495 of query aligns to 10:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R333), T337 (≠ F337), K348 (≠ C349), Y379 (vs. gap), H381 (= H382), H388 (= H389), H423 (= H427)
- binding flavin-adenine dinucleotide: W39 (≠ G44), P75 (= P80), Q76 (≠ R81), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (= G86), M82 (≠ L87), G85 (= G90), S86 (≠ A91), L139 (≠ P144), G140 (≠ S145), A141 (≠ S146), C145 (= C150), G149 (= G154), N150 (= N155), A152 (= A157), T153 (≠ E158), G157 (= G162), G207 (= G211), I212 (≠ V216), E422 (= E426), N459 (= N463)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E426)
Query Sequence
>HSERO_RS19105 FitnessBrowser__HerbieS:HSERO_RS19105
MNAPVQPSFAPARQREVVDALRRVVPAHCVLCDEEDTRPYECDGLAAYRQLPMVVVLPEN
EAQVVAIMKTCHALQVQIVPRGAGTGLSGGATPIADGVVVSTAKFNQILQMDKYSRTAVV
QPGVRNLAISEAAAPHGLYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTVHNVLRVRM
VTIEGEVVELGSGALDAPGLDLLAVFIGSEGMLGVVTEVTVKLVPKPQAARVIMASFDDV
VKGGNAVANVIAAGIIPAGLEMMDKTSSRMVEPFVKAGYDIDAEAILLCESDGTVEEVEE
EIGRMTDVLNASGATAIACSQSEAERLRFWSGRKNAFPAAGRISPDYYCMDGTIPRKKLA
QVLLGIAEMEKKYGLRCANVFHAGDGNLHPLILFDANIADEFHRAELFGAEILELCVEVG
GTITGEHGVGIEKINSMCVQFSPAERETFFKLKRAFDPAFLLNPDKAIPTLHRCAEYGKM
HVQRGQLRFPDLPRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory