SitesBLAST
Comparing HSERO_RS19115 FitnessBrowser__HerbieS:HSERO_RS19115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (= E44), P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W323 (≠ Y334), E414 (= E425), H415 (= H426), N451 (= N462)
- binding manganese (ii) ion: H370 (= H381), H377 (= H388), E414 (= E425)
- binding pyruvic acid: R319 (= R330), H370 (= H381), H377 (= H388), H415 (= H426)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R330), H369 (= H381), H376 (= H388), H414 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), H414 (= H426), N450 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
48% identity, 96% coverage: 16:467/471 of query aligns to 3:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), H414 (= H426), N450 (= N462)
- binding lactic acid: R318 (= R330), H369 (= H381), H376 (= H388), H414 (= H426)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), Y324 (≠ F335), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R330), W323 (≠ Y334), H415 (= H426)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R330), W323 (≠ Y334), H370 (= H381), H415 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H370 (= H381), E414 (= E425), N451 (= N462)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R330), W323 (≠ Y334), H415 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), Y324 (≠ F335), H370 (= H381), E414 (= E425), N451 (= N462)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R330), W323 (≠ Y334), H415 (= H426)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R330), H415 (= H426)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), Y324 (≠ F335), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L87), R319 (= R330), W323 (≠ Y334), H415 (= H426)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R330), W322 (≠ Y334), H369 (= H381), H376 (= H388), H414 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), N450 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (= E44), P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), H414 (= H426), N450 (= N462)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R330), H369 (= H381), H376 (= H388), H414 (= H426)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
48% identity, 96% coverage: 16:467/471 of query aligns to 3:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L87), R317 (= R330), W321 (≠ Y334), H368 (= H381), H375 (= H388), H413 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W321 (≠ Y334), Y322 (≠ F335), E412 (= E425), H413 (= H426), N449 (= N462)
- binding manganese (ii) ion: H368 (= H381), H375 (= H388), E412 (= E425)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
48% identity, 96% coverage: 16:467/471 of query aligns to 3:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H369 (= H381), E413 (= E425), N450 (= N462)
- binding deaminohydroxyvaline: R319 (= R330), H414 (= H426)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R330), W322 (≠ Y334), H369 (= H381), H376 (= H388), H413 (= H426)
- binding flavin-adenine dinucleotide: E32 (= E44), P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E412 (= E425), H413 (= H426), N449 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E425)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
49% identity, 96% coverage: 16:467/471 of query aligns to 3:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R330), W322 (≠ Y334), S336 (= S348), H369 (= H381), H376 (= H388), H413 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ A83), G72 (= G84), T73 (= T85), G74 (≠ S86), G78 (≠ H90), V79 (= V91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (≠ S155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), E412 (= E425), N449 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E425)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 91% coverage: 38:466/471 of query aligns to 31:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P80), G75 (= G82), S76 (≠ A83), G77 (= G84), T78 (= T85), G79 (≠ S86), L80 (= L87), A83 (≠ H90), C84 (≠ V91), P137 (= P144), G138 (= G145), E139 (vs. gap), A142 (= A148), T143 (≠ S149), G146 (= G152), N147 (≠ M153), S149 (= S155), T150 (= T156), A152 (= A158), G153 (≠ S159), E203 (= E209), G204 (= G210), I209 (= I215), E422 (= E425), H423 (= H426)
- binding fe (iii) ion: H377 (= H381), H384 (= H388), E422 (= E425)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 92% coverage: 35:467/471 of query aligns to 22:456/459 of P9WIT1
- K354 (≠ E360) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
29% identity, 96% coverage: 18:467/471 of query aligns to 6:465/465 of 3pm9A
- active site: A149 (= A158), L159 (≠ T168)
- binding flavin-adenine dinucleotide: P69 (= P80), Q70 (≠ Y81), G71 (= G82), G72 (≠ A83), N73 (≠ G84), T74 (= T85), G75 (≠ S86), L76 (= L87), G79 (≠ H90), Q80 (≠ V91), L91 (= L102), L133 (≠ P144), G134 (= G145), A135 (= A146), C139 (vs. gap), T140 (vs. gap), G142 (= G151), G143 (= G152), S146 (= S155), T147 (= T156), A149 (= A158), G150 (≠ S159), E200 (= E209), G201 (= G210), I205 (= I214), I206 (= I215), E423 (= E425)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
30% identity, 87% coverage: 60:467/471 of query aligns to 55:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R330), T337 (≠ Y334), K348 (≠ S348), Y379 (≠ I379), H381 (= H381), H388 (= H388), H423 (= H426)
- binding flavin-adenine dinucleotide: P75 (= P80), Q76 (≠ Y81), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (≠ S86), M82 (≠ L87), G85 (≠ H90), S86 (≠ V91), L139 (≠ P144), G140 (= G145), A141 (= A146), C145 (vs. gap), G149 (= G152), N150 (≠ M153), A152 (≠ S155), T153 (= T156), G157 (= G160), G207 (= G210), I212 (= I215), E422 (= E425), N459 (= N462)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E425)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
30% identity, 87% coverage: 60:467/471 of query aligns to 55:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P80), G77 (= G82), G78 (≠ A83), N79 (≠ G84), T80 (= T85), G81 (≠ S86), G85 (≠ H90), S86 (≠ V91), L139 (≠ P144), G140 (= G145), A141 (= A146), C145 (vs. gap), H146 (vs. gap), G148 (= G151), G149 (= G152), N150 (≠ M153), A152 (≠ S155), T153 (= T156), A155 (= A158), E206 (= E209), G207 (= G210), I211 (= I214), I212 (= I215), E422 (= E425), N459 (= N462)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R330), T337 (≠ Y334), K348 (≠ S348), Y379 (≠ I379), H381 (= H381), H388 (= H388), H423 (= H426)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E425)
Sites not aligning to the query:
Query Sequence
>HSERO_RS19115 FitnessBrowser__HerbieS:HSERO_RS19115
MNHLVDARKLKRPVPQALLDELKALFGDRCSTTLAMREHHGRDESSYDPMLPDAVVFAHS
TEEVAAFVKLCSQYDTPIIPYGAGTSLEGHVLALQGGVTVDLSQMNQVLAVHAEDLTATV
QAGVTRKQLNQEIKDTGLFFPIDPGADASLGGMASTRASGTNAVRYGTMKENTLTLTVVT
AQGEIIKTGTRAKKSSAGYDLTRVYVGSEGTLGIITEVTVRLYPQPEAISAAICSFPTVA
DAVNTVIQTIQMGVPLARVELLDENGVRAINAHDKLSLPVNPLLLFEFHGSENGVKEQAE
LVQDIAKEFHALGFEWATRPEDRTRLWTARHNAYFALLQLRPGARAISTDCCVPISRLAE
CVLATKADCEEQGLTHAIIGHVGDGNFHVQMMVDPNDPADIARAEGVNQRMVARAIGMDG
TCTGEHGVGLHKMDFLIQEHGEGAIAVMRAIKHALDPKNIMNPGKILRWEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory