SitesBLAST – Find functional sites

 

SitesBLAST

Comparing HSERO_RS19245 HSERO_RS19245 glutamate/aspartate transporter permease GltK to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 2 hits to proteins with known functional sites (download)

4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
33% identity, 91% coverage: 17:227/231 of query aligns to 14:214/215 of 4ymtC

query
sites
4ymtC
L
 
L
F
 
F
T
 
I
T
 
S
G
 
G
L
 
L
K
 
I
F
 
M
T
 
T
L
 
L
I
 
K
L
 
L
T
 
T
F
 
F
S
 
L
A
 
A
M
 
V
A
 
T
G
 
I
G
 
G
I
 
V
I
 
L
L
 
M
G
 
G
T
 
L
L
 
F
L
 
I
A
 
A
M
 
L
M
 
M
R
 
K
L
 
M
S
 
S
S
 
S
N
 
I
K
 
K
P
 
P
L
 
I
S
 
K
F
 
L
I
 
V
A
 
A
T
 
S
T
 
S
Y
 
Y
V
 
I
N
 
E
L
 
V
I
 
I
R
 
R
S
 
G
I
x
T
P
|
P
L
|
L
V
 
L
L
 
V
V
 
Q
I
 
L
F
 
L
W
 
L
F
 
I
Y
 
Y
F
 
N
L
 
-
V
 
-
P
 
-
F
 
-
I
 
-
G
 
G
A
 
L
W
 
M
M
 
Q
I
 
F
G
 
G
A
 
M
S
 
N
E
 
I
P
 
P
I
 
-
Q
 
-
V
 
-
G
 
-
A
 
A
F
 
F
Q
 
T
S
 
A
A
 
G
L
 
V
I
 
S
T
 
A
F
 
L
I
 
A
L
 
I
F
x
N
E
x
S
A
 
S
A
 
A
Y
|
Y
Y
 
V
C
 
A
E
 
E
I
 
I
M
 
I
R
 
R
S
 
A
G
 
G
I
 
I
Q
 
Q
S
 
A
I
 
V
P
 
D
R
 
P
G
 
G
Q
 
Q
V
 
N
F
 
E
A
 
A
G
 
A
Y
 
R
A
 
S
I
 
L
G
 
G
M
 
M
N
 
T
Y
 
H
W
 
A
Q
 
M
M
 
A
M
 
M
G
 
R
N
 
Y
V
 
V
V
 
I
L
 
I
P
 
P
Q
 
Q
A
 
A
F
 
I
R
 
K
N
 
N
M
 
I
T
 
L
P
 
P
I
 
A
L
 
L
L
 
G
T
 
N
Q
x
E
T
 
F
I
 
I
V
 
V
L
x
M
F
 
L
Q
x
K
D
x
E
V
 
S
S
 
A
L
 
I
V
 
V
Y
 
S
V
 
V
L
 
I
G
 
G
S
 
-
V
 
F
P
 
A
D
 
D
F
 
L
V
 
T
T
 
R
S
 
Q
A
 
A
S
 
D
K
 
I
I
 
I
A
 
Q
Q
 
S
R
 
V
D
 
T
G
 
Y
R
 
R
L
 
Y
V
 
F
E
 
E
M
 
P
Y
 
Y
L
 
I
F
 
I
V
 
I
A
 
A
V
 
A
V
 
I
Y
 
Y
F
 
F
V
 
V
L
 
M
S
 
T
F
 
L
G
 
T
L
 
F
S
 
S
T
 
K
L
 
L
V
 
L
K
 
S
R
 
L
F
 
F
Q
 
E
K
 
R
K
 
R
I
 
L

4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
33% identity, 91% coverage: 17:227/231 of query aligns to 14:214/214 of 4ymwC

query
sites
4ymwC
L
 
L
F
 
F
T
 
I
T
 
S
G
 
G
L
 
L
K
 
I
F
 
M
T
 
T
L
 
L
I
 
K
L
 
L
T
 
T
F
 
F
S
 
L
A
 
A
M
 
V
A
 
T
G
 
I
G
 
G
I
 
V
I
 
L
L
 
M
G
 
G
T
 
L
L
 
F
L
 
I
A
 
A
M
 
L
M
 
M
R
 
K
L
 
M
S
 
S
S
 
S
N
 
I
K
 
K
P
 
P
L
 
I
S
 
K
F
 
L
I
 
V
A
 
A
T
 
S
T
 
S
Y
 
Y
V
 
I
N
 
E
L
 
V
I
 
I
R
 
R
S
 
G
I
 
T
P
 
P
L
|
L
V
 
L
L
 
V
V
 
Q
I
 
L
F
 
L
W
 
L
F
 
I
Y
 
Y
F
 
N
L
 
-
V
 
-
P
 
-
F
 
-
I
 
-
G
 
G
A
 
L
W
 
M
M
 
Q
I
 
F
G
 
G
A
 
M
S
 
N
E
 
I
P
 
P
I
 
-
Q
 
-
V
 
-
G
 
-
A
 
A
F
 
F
Q
 
T
S
 
A
A
 
G
L
 
V
I
 
S
T
 
A
F
 
L
I
 
A
L
 
I
F
x
N
E
 
S
A
 
S
A
 
A
Y
|
Y
Y
 
V
C
 
A
E
 
E
I
 
I
M
 
I
R
 
R
S
 
A
G
 
G
I
 
I
Q
 
Q
S
 
A
I
 
V
P
 
D
R
 
P
G
 
G
Q
 
Q
V
 
N
F
 
E
A
 
A
G
 
A
Y
 
R
A
 
S
I
 
L
G
 
G
M
 
M
N
 
T
Y
 
H
W
 
A
Q
 
M
M
 
A
M
 
M
G
 
R
N
 
Y
V
 
V
V
 
I
L
 
I
P
 
P
Q
 
Q
A
 
A
F
 
I
R
 
K
N
 
N
M
 
I
T
 
L
P
 
P
I
 
A
L
 
L
L
 
G
T
 
N
Q
x
E
T
 
F
I
 
I
V
 
V
L
x
M
F
 
L
Q
 
K
D
x
E
V
 
S
S
 
A
L
 
I
V
 
V
Y
 
S
V
 
V
L
 
I
G
 
G
S
 
-
V
 
F
P
 
A
D
 
D
F
 
L
V
 
T
T
 
R
S
 
Q
A
 
A
S
 
D
K
 
I
I
 
I
A
 
Q
Q
 
S
R
 
V
D
 
T
G
 
Y
R
 
R
L
 
Y
V
 
F
E
 
E
M
 
P
Y
 
Y
L
 
I
F
 
I
V
 
I
A
 
A
V
 
A
V
 
I
Y
 
Y
F
 
F
V
 
V
L
 
M
S
 
T
F
 
L
G
 
T
L
 
F
S
 
S
T
 
K
L
 
L
V
 
L
K
 
S
R
 
L
F
 
F
Q
 
E
K
 
R
K
 
R
I
 
L

Query Sequence

>HSERO_RS19245 HSERO_RS19245 glutamate/aspartate transporter permease GltK
MFSNFDFDVIQRSWFYLFTTGLKFTLILTFSAMAGGIILGTLLAMMRLSSNKPLSFIATT
YVNLIRSIPLVLVIFWFYFLVPFIGAWMIGASEPIQVGAFQSALITFILFEAAYYCEIMR
SGIQSIPRGQVFAGYAIGMNYWQMMGNVVLPQAFRNMTPILLTQTIVLFQDVSLVYVLGS
VPDFVTSASKIAQRDGRLVEMYLFVAVVYFVLSFGLSTLVKRFQKKIAIIR

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory