SitesBLAST
Comparing HSERO_RS19280 FitnessBrowser__HerbieS:HSERO_RS19280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
49% identity, 97% coverage: 9:314/316 of query aligns to 4:310/311 of 3bazA
- active site: L98 (= L103), R230 (= R234), A251 (= A255), D254 (= D258), E259 (= E263), H277 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V79), G149 (= G154), L150 (= L155), G151 (= G156), R152 (= R157), I153 (= I158), S172 (≠ N177), R173 (= R178), S174 (= S179), C201 (≠ T205), P202 (= P206), T207 (= T211), I228 (≠ V232), G229 (≠ A233), R230 (= R234), D254 (= D258), H277 (= H281), G279 (≠ A283)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
49% identity, 97% coverage: 9:314/316 of query aligns to 6:312/313 of Q65CJ7
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
47% identity, 98% coverage: 5:314/316 of query aligns to 2:310/319 of 5v6qB
- active site: L96 (= L103), R230 (= R234), D254 (= D258), E259 (= E263), H277 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V79), V100 (= V107), F148 (≠ V153), L150 (= L155), G151 (= G156), R152 (= R157), I153 (= I158), T172 (≠ N177), R173 (= R178), V201 (≠ T205), P202 (= P206), S206 (≠ G210), T207 (= T211), V228 (= V232), G229 (≠ A233), R230 (= R234), H277 (= H281), A279 (= A283)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
47% identity, 98% coverage: 5:314/316 of query aligns to 1:309/319 of 5v7nA
- active site: L95 (= L103), R229 (= R234), D253 (= D258), E258 (= E263), H276 (= H281)
- binding 2-keto-D-gluconic acid: G70 (= G78), V71 (= V79), G72 (= G80), R229 (= R234), H276 (= H281), S279 (= S284), R285 (= R290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V79), V99 (= V107), L149 (= L155), G150 (= G156), R151 (= R157), I152 (= I158), T171 (≠ N177), R172 (= R178), V200 (≠ T205), P201 (= P206), S205 (≠ G210), T206 (= T211), V227 (= V232), G228 (≠ A233), R229 (= R234), H276 (= H281), A278 (= A283)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
47% identity, 98% coverage: 6:314/316 of query aligns to 1:308/318 of 5j23A
- active site: L94 (= L103), R228 (= R234), D252 (= D258), E257 (= E263), H275 (= H281)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V79), L148 (= L155), G149 (= G156), R150 (= R157), I151 (= I158), T170 (≠ N177), R171 (= R178), P200 (= P206), S204 (≠ G210), T205 (= T211), R228 (= R234)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
47% identity, 98% coverage: 6:314/316 of query aligns to 1:308/317 of 5v7gA
- active site: L94 (= L103), R228 (= R234), D252 (= D258), E257 (= E263), H275 (= H281)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V79), V98 (= V107), F146 (≠ V153), L148 (= L155), G149 (= G156), R150 (= R157), I151 (= I158), T170 (≠ N177), R171 (= R178), V199 (≠ T205), P200 (= P206), S204 (≠ G210), T205 (= T211), V226 (= V232), G227 (≠ A233), R228 (= R234), H275 (= H281), A277 (= A283)
- binding oxalate ion: G69 (= G78), V70 (= V79), G71 (= G80), R228 (= R234), H275 (= H281)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
47% identity, 79% coverage: 59:307/316 of query aligns to 56:314/334 of 5aovA
- active site: L100 (= L103), R241 (= R234), D265 (= D258), E270 (= E263), H288 (= H281)
- binding glyoxylic acid: Y74 (≠ F77), A75 (≠ G78), V76 (= V79), G77 (= G80), R241 (= R234), H288 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V79), T104 (≠ V107), F158 (≠ L155), G159 (= G156), R160 (= R157), I161 (= I158), S180 (≠ N177), R181 (= R178), A211 (≠ I204), V212 (≠ T205), P213 (= P206), T218 (= T211), I239 (≠ V232), A240 (= A233), R241 (= R234), H288 (= H281), G290 (≠ A283)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
45% identity, 96% coverage: 6:307/316 of query aligns to 1:313/332 of 6biiA
- active site: L99 (= L103), R240 (= R234), D264 (= D258), E269 (= E263), H287 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V79), T103 (≠ V107), G156 (= G154), F157 (≠ L155), G158 (= G156), R159 (= R157), I160 (= I158), A179 (≠ N177), R180 (= R178), S181 (= S179), K183 (= K181), V211 (≠ T205), P212 (= P206), E216 (≠ G210), T217 (= T211), V238 (= V232), A239 (= A233), R240 (= R234), D264 (= D258), H287 (= H281), G289 (≠ A283)
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
43% identity, 96% coverage: 6:307/316 of query aligns to 2:314/333 of 2dbqA
- active site: L100 (= L103), R241 (= R234), D265 (= D258), E270 (= E263), H288 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V79), T104 (≠ V107), L158 (= L155), G159 (= G156), R160 (= R157), I161 (= I158), S180 (≠ N177), R181 (= R178), T182 (≠ S179), A211 (≠ I204), V212 (≠ T205), P213 (= P206), T218 (= T211), I239 (≠ V232), A240 (= A233), R241 (= R234), D265 (= D258), H288 (= H281), G290 (≠ A283)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
43% identity, 96% coverage: 6:307/316 of query aligns to 2:314/334 of O58320
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
40% identity, 79% coverage: 39:287/316 of query aligns to 32:284/304 of 1wwkA
- active site: S96 (≠ L103), R230 (= R234), D254 (= D258), E259 (= E263), H278 (= H281)
- binding nicotinamide-adenine-dinucleotide: V100 (= V107), G146 (= G154), F147 (≠ L155), G148 (= G156), R149 (= R157), I150 (= I158), Y168 (vs. gap), D169 (vs. gap), P170 (≠ S174), V201 (≠ T205), P202 (= P206), T207 (= T211), T228 (≠ V232), S229 (≠ A233), D254 (= D258), H278 (= H281), G280 (≠ A283)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
36% identity, 78% coverage: 71:315/316 of query aligns to 75:323/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
36% identity, 78% coverage: 71:315/316 of query aligns to 71:319/324 of 2gcgA
- active site: L103 (= L103), R241 (= R234), D265 (= D258), E270 (= E263), H289 (= H281)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G78), V79 (= V79), G80 (= G80), R241 (= R234), H289 (= H281)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V79), T107 (≠ V107), G156 (= G154), G158 (= G156), I160 (= I158), G180 (≠ S179), R181 (= R180), R184 (≠ V183), C212 (≠ T205), S213 (≠ P206), T218 (= T211), I239 (≠ V232), R241 (= R234), D265 (= D258), H289 (= H281), G291 (≠ A283)
Sites not aligning to the query:
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
31% identity, 97% coverage: 7:314/316 of query aligns to 3:325/329 of 4e5mA
- active site: L100 (= L103), R237 (= R234), D261 (= D258), E266 (vs. gap), H292 (= H281)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K76 (≠ V79), L100 (= L103), T104 (≠ V107), G154 (= G156), A155 (≠ R157), I156 (= I158), R176 (= R178), L208 (≠ T205), P209 (= P206), T214 (= T211), P235 (≠ V232), C236 (≠ A233), R237 (= R234), H292 (= H281), G294 (≠ A283)
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
31% identity, 97% coverage: 7:314/316 of query aligns to 3:325/332 of 4e5pA
- active site: L100 (= L103), R237 (= R234), D261 (= D258), E266 (vs. gap), H292 (= H281)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ V79), L100 (= L103), T104 (≠ V107), G154 (= G156), A155 (≠ R157), I156 (= I158), A175 (≠ N177), R176 (= R178), L208 (≠ T205), P209 (= P206), T214 (= T211), P235 (≠ V232), C236 (≠ A233), R237 (= R234), H292 (= H281)
4e5kA Thermostable phosphite dehydrogenase in complex with NAD and sulfite (see paper)
31% identity, 97% coverage: 7:314/316 of query aligns to 3:325/329 of 4e5kA
- active site: L100 (= L103), R237 (= R234), D261 (= D258), E266 (vs. gap), H292 (= H281)
- binding nicotinamide-adenine-dinucleotide: K76 (≠ V79), G77 (= G80), L100 (= L103), T104 (≠ V107), G152 (= G154), G154 (= G156), A155 (≠ R157), I156 (= I158), H174 (= H176), E175 (≠ N177), A176 (≠ R178), A207 (≠ I204), L208 (≠ T205), P209 (= P206), P235 (≠ V232), C236 (≠ A233), R237 (= R234), D261 (= D258), H292 (= H281), G294 (≠ A283)
- binding sulfite ion: M53 (≠ G56), L75 (≠ G78), K76 (≠ V79), G77 (= G80), L100 (= L103), R237 (= R234), H292 (= H281)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
32% identity, 80% coverage: 35:286/316 of query aligns to 29:283/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
32% identity, 80% coverage: 35:286/316 of query aligns to 29:283/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V153), G147 (= G154), L148 (= L155), G149 (= G156), R150 (= R157), I151 (= I158), G152 (= G159), D170 (≠ H176), H201 (≠ I204), T202 (= T205), P203 (= P206)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
32% identity, 80% coverage: 35:286/316 of query aligns to 26:280/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G156), I148 (= I158), Y166 (= Y175), D167 (≠ H176), P168 (≠ N177), I169 (≠ R178), I170 (≠ S179), H198 (≠ I204), T199 (= T205), L208 (= L214), R228 (= R234)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
32% identity, 80% coverage: 35:286/316 of query aligns to 29:283/302 of 6rihA
Query Sequence
>HSERO_RS19280 FitnessBrowser__HerbieS:HSERO_RS19280
MTTNNRPHVLIVARLPQHLLDLLQQHYTCHNLILQPHSEAELAAIAPQIRGIAANGEAKV
SREFMARFPALEIVSVFGVGYDGVDVPAARERGIHVTHTPDVLNDDVADLAMALMLATAR
NVVRADRFARSGEWKKGPFPFTTKVSGARLGIVGLGRIGQAIAKRAAAFDMQISYHNRSR
KDVPYTYVDSITALAREVDFLVMITPGGAGTRALVNAEVLEALGPKGFLINVARGSVVDE
AALIAALKTGVIAGAGLDVFADEPNVPAELAALDNVVLTPHMASGTLVTRTAMADLAFNN
LQAHFSGAGVISPVPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory