SitesBLAST
Comparing HSERO_RS19365 FitnessBrowser__HerbieS:HSERO_RS19365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
58% identity, 98% coverage: 6:253/254 of query aligns to 2:244/245 of D4A1J4
- Y147 (= Y151) mutation to F: Loss of function.
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
58% identity, 98% coverage: 6:253/254 of query aligns to 2:244/245 of Q8JZV9
- Y147 (= Y151) active site, Proton acceptor; mutation to F: Loss of function.
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
54% identity, 98% coverage: 6:253/254 of query aligns to 2:244/245 of Q9BUT1
2ag5A Crystal structure of human dhrs6 (see paper)
54% identity, 98% coverage: 6:253/254 of query aligns to 2:244/246 of 2ag5A
- active site: S133 (= S137), Y147 (= Y151), K151 (= K155), R192 (≠ Q196)
- binding nicotinamide-adenine-dinucleotide: Q16 (= Q20), G17 (= G21), I18 (= I22), D37 (= D41), I38 (= I42), D58 (= D62), V59 (= V63), V81 (≠ C85), G83 (= G87), L104 (= L108), Y147 (= Y151), K151 (= K155), P177 (= P181), V180 (≠ I184), T182 (≠ S186), S184 (= S188)
- binding sulfate ion: R144 (= R148), R188 (= R192), F202 (= F211), R205 (= R214)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
36% identity, 97% coverage: 8:253/254 of query aligns to 5:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
36% identity, 97% coverage: 8:253/254 of query aligns to 5:246/255 of 2dteA
- active site: G18 (= G21), S132 (= S137), Y145 (= Y151), S148 (= S154), K149 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A17), S16 (≠ A19), M17 (≠ Q20), G18 (= G21), I19 (= I22), S38 (≠ D41), I39 (= I42), C52 (≠ L61), D53 (= D62), V54 (= V63), N80 (≠ C85), A81 (= A86), I130 (= I135), S132 (= S137), Y145 (= Y151), K149 (= K155), P174 (= P181), A175 (≠ G182), T176 (= T183), I177 (= I184), T179 (≠ S186), P180 (= P187), L181 (≠ S188), V182 (≠ L189)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases (see paper)
37% identity, 96% coverage: 11:253/254 of query aligns to 3:248/250 of 2cfcA
- active site: G13 (= G21), S142 (= S137), Y155 (= Y151), K159 (= K155)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ V145), R152 (= R148), Y155 (= Y151), W195 (≠ Q191), R196 (= R192)
- binding nicotinamide-adenine-dinucleotide: G9 (≠ A17), S12 (≠ Q20), G13 (= G21), N14 (≠ I22), D33 (= D41), L34 (≠ I42), A59 (≠ L61), D60 (= D62), V61 (= V63), N87 (≠ C85), A88 (= A86), G89 (= G87), I140 (= I135), P185 (= P181), G186 (= G182), M187 (≠ T183), I188 (= I184), T190 (≠ S186), P191 (= P187), M192 (≠ S188), T193 (≠ L189)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
37% identity, 96% coverage: 11:253/254 of query aligns to 3:248/250 of Q56840
- SGN 12:14 (≠ QGI 20:22) binding
- D33 (= D41) binding
- DV 60:61 (= DV 62:63) binding
- N87 (≠ C85) binding
- S142 (= S137) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R148) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y151) mutation Y->E,F: Loss of activity.
- K159 (= K155) mutation to A: Loss of activity.
- R179 (= R175) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IESPS 184:188) binding
- WR 195:196 (≠ QR 191:192) binding
- R196 (= R192) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R208) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R214) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 97% coverage: 7:253/254 of query aligns to 4:253/255 of 5itvA
- active site: G18 (= G21), S141 (= S137), Y154 (= Y151), K158 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A17), S17 (≠ Q20), G18 (= G21), I19 (= I22), D38 (= D41), I39 (= I42), T61 (vs. gap), I63 (≠ V63), N89 (≠ C85), G91 (= G87), T139 (≠ I135), S141 (= S137), Y154 (= Y151), K158 (= K155), P184 (= P181), G185 (= G182), I186 (≠ T183), I187 (= I184)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 98% coverage: 6:253/254 of query aligns to 1:246/248 of 6ixmC
- active site: G16 (= G21), S142 (= S137), Y155 (= Y151), K159 (= K155)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A17), S15 (≠ Q20), G16 (= G21), I17 (= I22), D36 (= D41), I37 (= I42), A61 (≠ L61), D62 (= D62), T63 (≠ V63), N89 (≠ C85), A90 (= A86), M140 (≠ I135), S142 (= S137), Y155 (= Y151), K159 (= K155), P185 (= P181), A186 (≠ G182), Y187 (≠ T183), I188 (= I184), L192 (≠ S188)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
35% identity, 96% coverage: 8:252/254 of query aligns to 2:252/255 of 2q2qD
- active site: G15 (= G21), S138 (= S137), Y151 (= Y151), K155 (= K155), R196 (≠ Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A17), T13 (≠ A19), S14 (≠ Q20), G15 (= G21), I16 (= I22), F36 (≠ I42), D59 (= D62), L60 (≠ V63), N86 (≠ C85), G88 (= G87), L109 (= L108), I136 (= I135), S138 (= S137), Y151 (= Y151), K155 (= K155), P181 (= P181), G182 (= G182), W183 (≠ T183), V184 (≠ I184), T186 (≠ S186), L188 (≠ S188), V189 (≠ L189)
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
36% identity, 98% coverage: 6:253/254 of query aligns to 2:258/262 of 5jc8D
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
32% identity, 98% coverage: 7:254/254 of query aligns to 3:248/249 of 4bmsF
- active site: S137 (≠ A138), H147 (≠ R148), Y150 (= Y151), K154 (= K155), Q195 (= Q196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (≠ A17), N15 (≠ A19), S16 (≠ Q20), I18 (= I22), R38 (≠ I42), R39 (≠ S43), A59 (≠ T58), D60 (≠ H59), V61 (≠ L60), N87 (≠ C85), S88 (≠ A86), G89 (= G87), V110 (≠ L108), S137 (≠ A138), Y150 (= Y151), K154 (= K155), G181 (= G182), I183 (= I184), T185 (≠ S186), I187 (≠ S188)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
33% identity, 98% coverage: 7:254/254 of query aligns to 3:248/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (≠ A138), H147 (≠ R148), Y150 (= Y151), L188 (= L189), L246 (≠ W252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (≠ A17), N15 (≠ A19), S16 (≠ Q20), G17 (= G21), I18 (= I22), R38 (≠ I42), R39 (≠ S43), D60 (≠ H59), V61 (≠ L60), N87 (≠ C85), S88 (≠ A86), G89 (= G87), V110 (≠ L108), T135 (≠ A136), S137 (≠ A138), Y150 (= Y151), K154 (= K155), P180 (= P181), G181 (= G182), A182 (≠ T183), I183 (= I184), T185 (≠ S186), S187 (= S188)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
33% identity, 98% coverage: 5:254/254 of query aligns to 5:252/258 of 4wecA
- active site: G21 (= G21), S143 (= S137), Q154 (≠ R148), Y157 (= Y151), K161 (= K155)
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A17), A19 (= A19), S20 (≠ Q20), G21 (= G21), I22 (= I22), D41 (= D41), I42 (= I42), V61 (≠ L61), D62 (= D62), V63 (= V63), N89 (≠ C85), T141 (≠ I135), Y157 (= Y151), K161 (= K155), P187 (= P181), P189 (≠ T183), V190 (≠ I184)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
34% identity, 99% coverage: 2:253/254 of query aligns to 5:264/267 of Q9LBG2
- 17:42 (vs. 14:39, 42% identical) binding
- E103 (≠ V89) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
32% identity, 96% coverage: 8:251/254 of query aligns to 6:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (≠ A17), S17 (≠ A19), R18 (≠ Q20), I20 (= I22), T40 (≠ I42), N62 (≠ D62), V63 (= V63), N89 (≠ C85), A90 (= A86), I92 (≠ Y88), V139 (≠ I135), S141 (= S137), Y154 (= Y151), K158 (= K155), P184 (= P181), G185 (= G182), I187 (= I184), T189 (≠ S186), M191 (≠ S188)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 95% coverage: 10:251/254 of query aligns to 5:240/244 of P0A2C9
- M125 (= M124) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A234) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S235) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
35% identity, 97% coverage: 7:253/254 of query aligns to 2:251/254 of 3toxA
- active site: G16 (= G21), S142 (= S137), V153 (≠ R148), Y156 (= Y151), K160 (= K155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (≠ A17), S14 (≠ A19), S15 (≠ Q20), G16 (= G21), I17 (= I22), A36 (≠ D41), R37 (≠ I42), N38 (≠ S43), V63 (= V63), N89 (≠ C85), A90 (= A86), G91 (= G87), T140 (≠ I135), S142 (= S137), Y156 (= Y151), K160 (= K155), P186 (= P181), G188 (≠ T183), T189 (≠ I184), T191 (≠ S186)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 95% coverage: 10:251/254 of query aligns to 5:240/244 of P0AEK2
- GASR 12:15 (≠ AAAQ 17:20) binding
- T37 (≠ I42) binding
- NV 59:60 (≠ DV 62:63) binding
- N86 (≠ C85) binding
- Y151 (= Y151) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YGASK 151:155) binding
- A154 (≠ S154) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K155) mutation to A: Defect in the affinity for NADPH.
- I184 (= I184) binding
- E233 (≠ S244) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
Query Sequence
>HSERO_RS19365 FitnessBrowser__HerbieS:HSERO_RS19365
MSASTGRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKPHLDELAGIAGVETHL
LDVTDDAAIKALVAKIGTIDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAV
LPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVAQGIRCNAIC
PGTIESPSLNQRISTQAKETGKSEEEVRAAFVGRQPMGRIGKAEEVAALALYLASDESNF
TTGSIHMIDGGWSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory