SitesBLAST
Comparing HSERO_RS19500 FitnessBrowser__HerbieS:HSERO_RS19500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
23% identity, 28% coverage: 197:570/1333 of query aligns to 50:359/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P223), G78 (= G225), G79 (= G226), N80 (≠ G227), T81 (= T228), G82 (= G229), M83 (≠ Y230), G86 (= G233), S87 (≠ A234), L140 (≠ T297), A142 (= A299), C146 (= C303), H147 (vs. gap), G150 (= G306), N151 (= N307), A153 (= A309), T154 (≠ M310), G208 (= G413), I212 (≠ L417), I213 (= I418)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
23% identity, 28% coverage: 197:570/1333 of query aligns to 49:358/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R544), T337 (= T547), K348 (= K558)
- binding flavin-adenine dinucleotide: P75 (= P223), Q76 (≠ R224), G77 (= G225), G78 (= G226), N79 (≠ G227), T80 (= T228), G81 (= G229), M82 (≠ Y230), G85 (= G233), S86 (≠ A234), L139 (≠ T297), G140 (≠ S298), A141 (= A299), C145 (= C303), G149 (= G306), N150 (= N307), A152 (= A309), T153 (≠ M310), G157 (= G314), G207 (= G413), I212 (= I418)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
23% identity, 28% coverage: 197:570/1333 of query aligns to 49:358/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P223), G77 (= G225), G78 (= G226), N79 (≠ G227), T80 (= T228), G81 (= G229), G85 (= G233), S86 (≠ A234), L139 (≠ T297), G140 (≠ S298), A141 (= A299), C145 (= C303), H146 (vs. gap), G148 (= G305), G149 (= G306), N150 (= N307), A152 (= A309), T153 (≠ M310), A155 (= A312), E206 (= E412), G207 (= G413), I211 (≠ L417), I212 (= I418)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R544), T337 (= T547), K348 (= K558)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
23% identity, 28% coverage: 197:570/1333 of query aligns to 49:358/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (= P223), G77 (= G225), G78 (= G226), N79 (≠ G227), T80 (= T228), G81 (= G229), G85 (= G233), S86 (≠ A234), L139 (≠ T297), G140 (≠ S298), A141 (= A299), C145 (= C303), H146 (vs. gap), G149 (= G306), N150 (= N307), A152 (= A309), T153 (≠ M310), A155 (= A312), G157 (= G314), E206 (= E412), G207 (= G413), I211 (≠ L417), I212 (= I418)
- binding d-malate: M82 (≠ Y230), R333 (= R544), T337 (= T547), K348 (= K558)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
23% identity, 28% coverage: 197:570/1333 of query aligns to 49:358/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R544), T337 (= T547), K348 (= K558)
- binding flavin-adenine dinucleotide: P75 (= P223), G77 (= G225), G78 (= G226), N79 (≠ G227), T80 (= T228), G81 (= G229), M82 (≠ Y230), G85 (= G233), S86 (≠ A234), L139 (≠ T297), G140 (≠ S298), A141 (= A299), C145 (= C303), G149 (= G306), N150 (= N307), A152 (= A309), T153 (≠ M310), A155 (= A312), G157 (= G314), G207 (= G413), I212 (= I418)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
26% identity, 29% coverage: 180:572/1333 of query aligns to 25:347/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ Y230), R317 (= R544), W321 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), W321 (vs. gap), Y322 (vs. gap)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
23% identity, 28% coverage: 197:570/1333 of query aligns to 102:411/521 of Q8N465
- S109 (≠ E204) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ I222) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G226) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V243) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L249) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V276) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A293) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A309) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P335) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G337) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S533) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R544) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (= T547) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ A556) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K558) binding ; binding ; mutation to A: Loss of catalytic activity.
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A187), P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), W323 (vs. gap)
- binding pyruvic acid: R319 (= R544)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), Y324 (vs. gap)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R544), W323 (vs. gap)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R544), W323 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R544), W323 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), Y324 (vs. gap)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R544), W323 (vs. gap)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R544)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:349/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), Y324 (vs. gap)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ Y230), R319 (= R544), W323 (vs. gap)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:348/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R544), W322 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), W322 (vs. gap)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:348/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R544)
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), W322 (vs. gap)
Sites not aligning to the query:
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:348/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418)
- binding deaminohydroxyvaline: R319 (= R544)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:348/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), W322 (vs. gap)
- binding lactic acid: R318 (= R544)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
25% identity, 29% coverage: 180:572/1333 of query aligns to 25:348/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A187), P68 (= P223), G70 (= G225), T71 (≠ G226), G72 (= G227), T73 (= T228), G74 (= G229), G78 (= G233), V79 (≠ A234), L90 (≠ T246), P132 (= P296), G133 (≠ T297), A134 (≠ S298), G140 (= G306), M141 (≠ N307), A143 (= A309), T144 (≠ M310), A146 (= A312), S147 (≠ G313), E200 (= E412), G201 (= G413), I206 (= I418), W322 (vs. gap)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R544)
Sites not aligning to the query:
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
29% identity, 12% coverage: 162:325/1333 of query aligns to 5:162/465 of 3pm9A
- active site: A149 (= A312), L159 (≠ T322)
- binding flavin-adenine dinucleotide: P69 (= P223), Q70 (≠ R224), G71 (= G225), G72 (= G226), N73 (≠ G227), T74 (= T228), G75 (= G229), L76 (≠ Y230), G79 (= G233), Q80 (≠ A234), L91 (≠ T246), L133 (≠ T297), G134 (≠ S298), A135 (= A299), C139 (= C303), T140 (vs. gap), G142 (= G305), G143 (= G306), S146 (≠ A309), T147 (≠ M310), A149 (= A312), G150 (= G313)
Sites not aligning to the query:
Query Sequence
>HSERO_RS19500 FitnessBrowser__HerbieS:HSERO_RS19500
MNAPAQIQALLTDAPHGATPPRLREIPYNYTSFSDREIVIRLLGEESWSLLDELRGKRQT
GRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRAALIEALNHRLGEVDKRRLATDQAEA
GDAEAQRRSASVEALLKAAKKAIADFAEEFRQTYDLRKRATKVLGRFTAKDNIKFDGLSR
VSHVTDATDWRVEYPFVVLTPDTEDEMAGLVKACIELGLTIIPRGGGTGYTGGAIPLTPM
SAVINTEKLEQLGAVEMEILPGLDKPYATIYSGAGVVTKRVSDAAEKAGFVFAVDPTSAE
ASCIGGNVAMNAGGKKAVLWGTALDNLASWRMVDPQGDWLEVTRLDHNLGKIHDVEVARF
KLEWSHPGEKGQKTEVFKTEILEISGKKFRKEGLGKDVTDKFLSGLPGVQKEGCDGLITS
ARWILHKMPKQTRTVCLEFFGQARDAIPSIVEIKDYLDAETKKGGAILAGLEHLDERYLR
AVGYATKSKRGVLPKMVLIGDIVGDDENAVAAAASEVIRMANNRVGEGFVAVSPEARKKF
WLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGIERINIELSIKNKLQLLAELDSFF
VKGNLPLGKSDDAEGDDIPAAEMLEDRVHQAESLLEQTHARWSYLLANLDKPLGEAKGEL
AALGLEKMLPVFEQRLVDQPEAAVFHVVQDRTVRISWKQEVRAQLRQIFSGAAFKLILEE
CQAIHKRVLRGRVFVALHMHAGDGNVHTNIPVNSDHYEMLQDAHVAVARIMKLARSLNGV
ISGEHGIGITKLEFLTEDEIGEFREYKKRVDPEGRFNKGKLLNLPGMEADLSNAYTPSFG
LMGHESLIMQQSDIGAIASSVKDCLRCGKCKPVCSTHVPRANLLYSPRNKILATSLLVEA
FLYEEQTRRGVSIKHWEEFEDVADHCTVCHKCVTPCPVDIDFGDVSMNMRNLLRKMGKKS
FNAGTNAAMFFLNATDPATINATRKVMTQWGFKAQRLGNDLMKKFAKKQTQKPPATVGKP
PVKEQVIHFINKKMPGNLPKKTARALLDIEDDKIVPIIRNPKTTTADTEAVFYFPGCGSE
RLFSQVGLATQAMLWNVGVQTVLPPGYLCCGYPQRGTGDFEKGEKIITDNRVLFHRMANT
LNYLDIKTVVVSCGTCYDQLQGYEFEKIFPGCRIIDIHEYLLEKGVKLEGVTGTRYMYHD
PCHSPMKQQDPLKTVNSLITTIDAQKIEKNDRCCGESGTFGVSRPDVSTQVRFRKEEEMR
KGSDKVRADGFTGDVKILTSCPSCFQGLSRYNEDAGTTADYIVVEMARHLLGENWMPEYV
ERANNGGIERILV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory