Comparing HSERO_RS20335 FitnessBrowser__HerbieS:HSERO_RS20335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
35% identity, 92% coverage: 21:364/372 of query aligns to 9:355/364 of 3cq6A
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
35% identity, 92% coverage: 21:364/372 of query aligns to 11:357/366 of 3cq5B
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
33% identity, 88% coverage: 37:365/372 of query aligns to 32:356/360 of 8bj3A
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
31% identity, 96% coverage: 9:364/372 of query aligns to 2:357/369 of 4r8dA
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
32% identity, 94% coverage: 17:365/372 of query aligns to 4:349/353 of 7szpA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
31% identity, 94% coverage: 17:366/372 of query aligns to 4:350/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
31% identity, 94% coverage: 17:366/372 of query aligns to 4:350/354 of 1fg3A
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
26% identity, 86% coverage: 46:366/372 of query aligns to 29:333/335 of 2f8jA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 86% coverage: 46:366/372 of query aligns to 28:332/335 of Q9X0D0
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 86% coverage: 46:366/372 of query aligns to 22:326/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
26% identity, 86% coverage: 46:366/372 of query aligns to 23:327/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
26% identity, 86% coverage: 46:366/372 of query aligns to 23:327/329 of 1h1cA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
32% identity, 88% coverage: 40:365/372 of query aligns to 16:335/335 of 1geyA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
32% identity, 92% coverage: 21:362/372 of query aligns to 5:343/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
32% identity, 92% coverage: 21:362/372 of query aligns to 5:343/353 of 4r2nA
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
28% identity, 90% coverage: 35:369/372 of query aligns to 15:350/355 of 1lkcA
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
28% identity, 90% coverage: 35:369/372 of query aligns to 19:354/358 of 1lc7A
Sites not aligning to the query:
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
28% identity, 90% coverage: 35:369/372 of query aligns to 16:351/356 of 1lc8A
Sites not aligning to the query:
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 90% coverage: 35:369/372 of query aligns to 22:357/364 of P97084
Sites not aligning to the query:
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
29% identity, 84% coverage: 59:372/372 of query aligns to 51:368/369 of 4wbtA
>HSERO_RS20335 FitnessBrowser__HerbieS:HSERO_RS20335
MKPSVPKPEPESIDQLIANVIRPVVRGWQSYHVPSAEGMVKLDAMENPYLLPAELREQLA
QRLAALELNRYPVPSYTALKAAICKGLGVPAGYDVLLGNGSDELITLLSVACAQPGRTIL
APEPGFVMYGVSAKMAGLEYVGVPLCADLSLDLPAMLAAMEAHKPVITWLGYPNNPTGTL
YEMADVLRIVEAAAPYGLVVVDEAYQPFAASTLMPALPQHNNLVLMRTVSKLGLAGIRLG
YLSAAPALLRELDKVRPPYNVNVLTEAAALFMLEHLDVLQAQAARLRQARSALAAELAAL
DGVQVFPSAANFLLIRVPDADKVCASLLAHRVLVKNAGRMHVLLQNCLRITVSSDKENAM
FLAALKTALREL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory