Comparing HSERO_RS20630 FitnessBrowser__HerbieS:HSERO_RS20630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
24% identity, 97% coverage: 7:352/356 of query aligns to 442:753/753 of 6laaA
Sites not aligning to the query:
1cnfA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
28% identity, 61% coverage: 13:230/356 of query aligns to 11:247/260 of 1cnfA
P17571 Nitrate reductase [NADH] 1; NR; EC 1.7.1.1 from Zea mays (Maize) (see 3 papers)
28% identity, 61% coverage: 13:230/356 of query aligns to 372:608/621 of P17571
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
26% identity, 65% coverage: 16:245/356 of query aligns to 23:254/255 of 7romA
1cneA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
27% identity, 61% coverage: 13:230/356 of query aligns to 11:247/260 of 1cneA
Sites not aligning to the query:
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 57% coverage: 39:240/356 of query aligns to 81:280/281 of Q9ZNT1
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
22% identity, 68% coverage: 7:248/356 of query aligns to 106:334/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
22% identity, 68% coverage: 7:248/356 of query aligns to 105:333/333 of 5ogxA
Sites not aligning to the query:
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
25% identity, 89% coverage: 36:352/356 of query aligns to 484:765/765 of 6kbhA
Sites not aligning to the query:
5ylyB Crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase (see paper)
26% identity, 56% coverage: 39:236/356 of query aligns to 44:262/269 of 5ylyB
7ylrA Structure of a bacteria protein
27% identity, 78% coverage: 73:351/356 of query aligns to 82:326/326 of 7ylrA
Sites not aligning to the query:
A0A286R227 Nitrate reductase [NADH]; NR; EC 1.7.1.1 from Ulva prolifera (Green seaweed) (Enteromorpha prolifera) (see paper)
26% identity, 58% coverage: 39:243/356 of query aligns to 638:863/863 of A0A286R227
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
42% identity, 19% coverage: 282:350/356 of query aligns to 21:89/97 of 7s3dX
3b2gA Leptolyngbya boryana ferredoxin (see paper)
39% identity, 21% coverage: 282:356/356 of query aligns to 22:96/98 of 3b2gA
4zhoA The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster (see paper)
49% identity, 17% coverage: 286:346/356 of query aligns to 24:84/97 of 4zhoA
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
42% identity, 19% coverage: 282:350/356 of query aligns to 21:89/97 of 7fixR1
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
42% identity, 19% coverage: 282:350/356 of query aligns to 22:90/98 of 6khi1
P27787 Ferredoxin-1, chloroplastic; Ferredoxin I; Fd I from Zea mays (Maize) (see 2 papers)
44% identity, 18% coverage: 286:349/356 of query aligns to 76:139/150 of P27787
Sites not aligning to the query:
7aktA Crpetf variant - a39g_a41v
46% identity, 17% coverage: 286:346/356 of query aligns to 35:95/107 of 7aktA
Q8IED5 Ferredoxin, apicoplast from Plasmodium falciparum (isolate 3D7) (see paper)
42% identity, 18% coverage: 282:346/356 of query aligns to 116:180/194 of Q8IED5
>HSERO_RS20630 FitnessBrowser__HerbieS:HSERO_RS20630
MSKFYPLTISDVKQETRDTIVVSFAVPAELQDTFSYQQGQHLTLRSEINGEDLRRSYSIC
SAVQERQLRVAIKRAPGGLFSNWANESFVPGQRIDVMPPMGHFNVPLEAGNRKHYLAFAA
GSGITPMMSIIKTTLLSEPHSHFTLVYANRASSSVIFKEELTDLKDAYLERFNVVYVMSR
EQQDVELFNGRIDRAKCDAFFASWIDLKDVDAAFLCGPEEMVQAVAASLQAHGLPKTQIK
TELFAASTPPRAHAARTVVGKQECEVTVIVDGYHNVFTMDKEKESVLEAGLKHGIDLRYS
CKGGVCATCRCKVVEGKVDMDANYALEDYEIARGFVLSCQSFPVSDKLLLDFDQDN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory