SitesBLAST
Comparing HSERO_RS20920 FitnessBrowser__HerbieS:HSERO_RS20920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
57% identity, 61% coverage: 218:579/596 of query aligns to 60:427/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
58% identity, 58% coverage: 237:579/596 of query aligns to 1:347/365 of 3zokA
- active site: R122 (= R356), K144 (= K378), E186 (= E420), K228 (= K462), E238 (= E472), R242 (= R476), N246 (= N480), H249 (= H483), H253 (= H487), H266 (= H500)
- binding glycine: K144 (= K378), K228 (= K462), R242 (= R476)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ K280), V45 (= V281), D73 (= D307), E75 (= E309), K78 (= K312), G106 (= G340), G107 (= G341), V108 (= V342), D111 (= D345), T131 (= T365), T132 (= T366), M134 (≠ L368), D138 (= D372), S139 (= S373), K144 (= K378), K153 (= K387), T174 (= T408), L175 (= L409), E179 (= E413), H266 (= H500)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
52% identity, 59% coverage: 240:593/596 of query aligns to 4:358/361 of Q9KNV2
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
55% identity, 57% coverage: 239:580/596 of query aligns to 4:338/355 of 5eksA
- active site: R120 (= R356), K142 (= K378), E184 (= E420), K226 (= K462), R237 (= R476), N241 (= N480), H244 (= H483), H248 (= H487), H261 (= H500)
- binding magnesium ion: E184 (= E420), H244 (= H483), H261 (= H500)
- binding nicotinamide-adenine-dinucleotide: N42 (= N278), V45 (= V281), D71 (= D307), E73 (= E309), K76 (= K312), G104 (= G340), G105 (= G341), V106 (= V342), D109 (= D345), T129 (= T365), T130 (= T366), D136 (= D372), S137 (= S373), K142 (= K378), T172 (= T408), L173 (= L409), E177 (= E413)
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
52% identity, 59% coverage: 240:593/596 of query aligns to 5:357/360 of 3okfA
- active site: R120 (= R356), K142 (= K378), E184 (= E420), K226 (= K462), R238 (= R476), N242 (= N480), H245 (= H483), H249 (= H487), H262 (= H500)
- binding nicotinamide-adenine-dinucleotide: N42 (= N278), L48 (= L284), D71 (= D307), E73 (= E309), K76 (= K312), G104 (= G340), G105 (= G341), V106 (= V342), D109 (= D345), T129 (= T365), T130 (= T366), L132 (= L368), D136 (= D372), T172 (= T408), L173 (= L409), E177 (= E413)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
53% identity, 59% coverage: 240:593/596 of query aligns to 5:361/363 of 6llaB
- active site: R121 (= R356), K143 (= K378), E185 (= E420), K227 (= K462), E237 (= E472), R242 (= R476), N246 (= N480), H249 (= H483), H253 (= H487), H266 (= H500)
- binding magnesium ion: E185 (= E420), H249 (= H483), H266 (= H500)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V281), D72 (= D307), E74 (= E309), K77 (= K312), G105 (= G340), G106 (= G341), V107 (= V342), D110 (= D345), T130 (= T365), T131 (= T366), L133 (= L368), D137 (= D372), K143 (= K378), T173 (= T408), L174 (= L409), E178 (= E413)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
53% identity, 59% coverage: 240:593/596 of query aligns to 5:357/357 of 6lk2A
- active site: R121 (= R356), K143 (= K378), E185 (= E420), K227 (= K462), R238 (= R476), N242 (= N480), H245 (= H483), H249 (= H487), H262 (= H500)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D372), E185 (= E420), K227 (= K462), R238 (= R476), N242 (= N480), H245 (= H483), T246 (= T484), H249 (= H487), H262 (= H500)
- binding magnesium ion: E185 (= E420), H245 (= H483), H262 (= H500)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V281), D72 (= D307), E74 (= E309), K77 (= K312), G105 (= G340), G106 (= G341), V107 (= V342), D110 (= D345), T130 (= T365), T131 (= T366), L133 (= L368), D137 (= D372), S138 (= S373), C170 (≠ T405), T173 (= T408), L174 (= L409), P175 (= P410), E178 (= E413)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
50% identity, 55% coverage: 248:575/596 of query aligns to 14:340/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
49% identity, 55% coverage: 248:575/596 of query aligns to 17:335/354 of 5hvnA
- active site: R123 (= R356), K145 (= K378), E187 (= E420), K228 (= K462), R239 (= R476), N243 (= N480), H246 (= H483), H250 (= H487), H263 (= H500)
- binding nicotinamide-adenine-dinucleotide: N45 (= N278), L51 (= L284), D73 (= D307), E75 (= E309), K78 (= K312), G107 (= G340), G108 (= G341), V109 (= V342), D112 (= D345), T132 (= T365), T133 (= T366), L135 (= L368), D139 (= D372), K145 (= K378), F172 (≠ T405), T175 (= T408), L176 (= L409), E180 (= E413)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
40% identity, 59% coverage: 242:590/596 of query aligns to 6:339/343 of P56081
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
47% identity, 45% coverage: 305:574/596 of query aligns to 72:365/1555 of 6hqvA
- active site: R123 (= R356), K145 (= K378), E187 (= E420), K243 (= K462), E253 (= E472), R257 (= R476), N261 (= N480), H264 (= H483), H268 (= H487), H280 (= H500)
- binding glutamic acid: D139 (= D372), K145 (= K378), E187 (= E420), K243 (= K462), R257 (= R476), H264 (= H483), H280 (= H500)
- binding nicotinamide-adenine-dinucleotide: E76 (= E309), K79 (= K312), G107 (= G340), G108 (= G341), V109 (= V342), D112 (= D345), T132 (= T365), T133 (= T366), L135 (= L368), D139 (= D372), S140 (= S373), K145 (= K378), K154 (= K387), T175 (= T408), L176 (= L409), P177 (= P410), E180 (= E413), H280 (= H500)
- binding zinc ion: E187 (= E420), H264 (= H483), H280 (= H500)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
41% identity, 55% coverage: 253:579/596 of query aligns to 7:367/381 of 1dqsA
- active site: R127 (= R356), K149 (= K378), E191 (= E420), K240 (= K462), E250 (= E472), R254 (= R476), N258 (= N480), H261 (= H483), H265 (= H487), H277 (= H500)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D372), K149 (= K378), N159 (= N388), E191 (= E420), K240 (= K462), R254 (= R476), L257 (= L479), N258 (= N480), H261 (= H483), H265 (= H487), H277 (= H500), K346 (= K558)
- binding nicotinamide-adenine-dinucleotide: D41 (≠ N278), N43 (≠ K280), I44 (≠ V281), E78 (= E309), K81 (= K312), G111 (= G340), G112 (= G341), V113 (= V342), D116 (= D345), T136 (= T365), T137 (= T366), L139 (= L368), D143 (= D372), S144 (= S373), K158 (= K387), T179 (= T408), P181 (= P410), E184 (= E413), H277 (= H500)
- binding zinc ion: E191 (= E420), H261 (= H483), H277 (= H500)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
41% identity, 55% coverage: 253:579/596 of query aligns to 10:377/1583 of P07547
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
40% identity, 55% coverage: 253:579/596 of query aligns to 8:375/391 of 1nvbB
- active site: R128 (= R356), K150 (= K378), E192 (= E420), K248 (= K462), E258 (= E472), R262 (= R476), N266 (= N480), H269 (= H483), H273 (= H487), H285 (= H500)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D372), K150 (= K378), N160 (= N388), E192 (= E420), K248 (= K462), R262 (= R476), L265 (= L479), N266 (= N480), H269 (= H483), H273 (= H487), K354 (= K558)
- binding zinc ion: E192 (= E420), H269 (= H483), H285 (= H500)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
41% identity, 57% coverage: 236:576/596 of query aligns to 6:341/362 of P9WPX9
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
41% identity, 49% coverage: 242:532/596 of query aligns to 3:268/308 of 3clhA
- active site: R107 (= R356), K129 (= K378), E171 (= E420), K207 (= K462), R212 (= R476), N216 (= N480), H219 (= H483), H223 (= H487), H236 (= H500)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ K280), V34 (= V281), H38 (≠ Y285), S58 (≠ D307), E60 (= E309), K63 (= K312), G91 (= G340), G92 (= G341), V93 (= V342), D96 (= D345), T116 (= T365), T117 (= T366), L119 (= L368), D123 (= D372), A124 (≠ S373), K129 (= K378), N139 (= N388), T159 (= T408), L160 (= L409), E164 (= E413)
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
44% identity, 47% coverage: 294:574/596 of query aligns to 69:365/385 of 6c5cA
- active site: R130 (= R356), K152 (= K378), E194 (= E420), K246 (= K462), E254 (= E472), R258 (= R476), N262 (= N480), H265 (= H483), H269 (= H487), H281 (= H500)
- binding nicotinamide-adenine-dinucleotide: E83 (= E309), K86 (= K312), G114 (= G340), G115 (= G341), V116 (= V342), D119 (= D345), T139 (= T365), T140 (= T366), D146 (= D372), S147 (= S373), F179 (≠ T405), T182 (= T408), L183 (= L409), Q187 (≠ E413)
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
41% identity, 57% coverage: 236:576/596 of query aligns to 1:332/352 of 3qbeA
- active site: R117 (= R356), K139 (= K378), E181 (= E420), K223 (= K462), R233 (= R476), N237 (= N480), H240 (= H483), H244 (= H487), H256 (= H500)
- binding zinc ion: E181 (= E420), H240 (= H483), H256 (= H500)
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
38% identity, 55% coverage: 253:579/596 of query aligns to 7:365/380 of 1nvaA
- active site: R127 (= R356), K149 (= K378), E191 (= E420), K247 (≠ E472), R257 (= R476), N261 (= N480), H264 (= H483), H268 (= H487), H280 (= H500)
- binding adenosine-5'-diphosphate: D41 (≠ N278), N43 (≠ K280), G111 (= G340), G112 (= G341), T136 (= T365), T137 (= T366), F176 (≠ T405), T179 (= T408), L180 (= L409)
- binding zinc ion: E191 (= E420), H264 (= H483), H280 (= H500)
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
39% identity, 57% coverage: 236:576/596 of query aligns to 1:324/344 of 3qbdA
- active site: R117 (= R356), K139 (= K378), E181 (= E420), K223 (= K462), R232 (= R471), N236 (= N480), H239 (= H483), H243 (= H487), H255 (= H500)
- binding nicotinamide-adenine-dinucleotide: Q40 (≠ N278), D68 (= D307), A69 (≠ G308), E70 (= E309), K73 (= K312), G101 (= G340), G102 (= G341), A103 (≠ V342), D106 (= D345), T126 (= T365), T127 (= T366), L129 (= L368), A134 (≠ S373), T169 (= T408), L170 (= L409)
Query Sequence
>HSERO_RS20920 FitnessBrowser__HerbieS:HSERO_RS20920
MTGSIFLVGLMGAGKTTIGRALAKKLNKRFIDSDHEIEARTGATIPVIFEIEGEENFRRR
EAEVIRELTALPDIVLATGGGAILRAENRDNLKKGGTVVYLRASINQILQRTGRDKNRPL
LQTADPRRKLEELSRQRDPLYRDVADFVIETNRPNVQFLVQTIISHLELSPPESSWQSAP
AADETIVIERSSALVTSAADGAVVVSTSHTSQTFHGAASAEPTLARMNQNTASAPAPITL
NVDLGERSYPIHIGRGLLDDAGLLPQYVKGKRVAIVTNDKVGPLYLDKVAQPLRAAGKLV
TEIVLPDGEEEKNWASLMKIFDRLLADKCDRKTTLIALGGGVIGDLTGFAAASYMRGVPF
VQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAVIADTATLHTLPPRELSAGIAE
VIKHGAIIDAPFFDWIETNIAQLVSKDDAALAYAIQRSCEIKAEVVRQDEREGGLRAILN
FGHTFGHAIENGLGYGQWLHGEAVGCGMVMAADLSHRLGYIDAGARDRVRALTAAAGLPT
VAPDLGVARWLELMEVDKKNEGGQIKFILIRPLGSPLITNVPQDLLLQTLAACTGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory