Comparing HSERO_RS20985 FitnessBrowser__HerbieS:HSERO_RS20985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
64% identity, 96% coverage: 6:185/188 of query aligns to 6:188/191 of 3mqhA
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
64% identity, 96% coverage: 6:185/188 of query aligns to 7:189/192 of 3mqgC
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
62% identity, 96% coverage: 1:181/188 of query aligns to 1:182/191 of G3XD01
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
43% identity, 80% coverage: 6:155/188 of query aligns to 3:144/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
43% identity, 80% coverage: 6:155/188 of query aligns to 3:143/290 of 4mzuB
Sites not aligning to the query:
7s42A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- galactose (see paper)
49% identity, 71% coverage: 6:138/188 of query aligns to 5:135/145 of 7s42A
7s41A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- glucose (see paper)
49% identity, 71% coverage: 6:138/188 of query aligns to 5:135/145 of 7s41A
7s3wA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d- galactose (see paper)
49% identity, 71% coverage: 6:138/188 of query aligns to 5:135/145 of 7s3wA
7s3uA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose (see paper)
49% identity, 71% coverage: 6:138/188 of query aligns to 5:135/145 of 7s3uA
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
48% identity, 71% coverage: 6:138/188 of query aligns to 5:131/141 of 7s45A
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
32% identity, 81% coverage: 17:168/188 of query aligns to 89:234/260 of 3fsbA
Sites not aligning to the query:
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
32% identity, 81% coverage: 17:168/188 of query aligns to 89:234/259 of 3fscA
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d- glucose n-acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
32% identity, 81% coverage: 17:168/188 of query aligns to 89:234/259 of 3fs8A
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
33% identity, 56% coverage: 48:152/188 of query aligns to 72:181/190 of 5u2kA
Q5KW03 Carbonic anhydrase; Gamma-carbonic anhydrase; Cag; EC 4.2.1.1 from Geobacillus kaustophilus (strain HTA426) (see paper)
30% identity, 72% coverage: 16:150/188 of query aligns to 11:138/182 of Q5KW03
Sites not aligning to the query:
3vnpA Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
30% identity, 72% coverage: 16:150/188 of query aligns to 12:139/171 of 3vnpA
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
32% identity, 65% coverage: 29:150/188 of query aligns to 140:238/257 of 1ssqD
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
34% identity, 55% coverage: 51:153/188 of query aligns to 165:248/272 of 3gvdI
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
31% identity, 60% coverage: 39:150/188 of query aligns to 66:176/183 of 3nz2C
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
31% identity, 60% coverage: 39:150/188 of query aligns to 59:169/176 of 3ectA
>HSERO_RS20985 FitnessBrowser__HerbieS:HSERO_RS20985
MTYHAHETALVDEGAQIGEATRIWHWAHICSGARIGERCSFGQNVFVGNDVLIGNNVKVQ
NNVSIYDAVTLEDDVFCGPSMVFTNVNNPRSAVSRKHEYRRTLVRRGASIGANATIVCGH
EIGEYAFIGAGAVVTRDVPAYALMVGTPARRIGWMCRCGERLSTAESVTICTECNSRYQI
SDSFCEPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory