Comparing HSERO_RS21020 FitnessBrowser__HerbieS:HSERO_RS21020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gpwC Structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. (see paper)
42% identity, 82% coverage: 1:208/253 of query aligns to 1:207/253 of 1gpwC
Sites not aligning to the query:
Q9X0C6 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
42% identity, 82% coverage: 1:208/253 of query aligns to 1:207/253 of Q9X0C6
7ac8A Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
42% identity, 82% coverage: 1:208/253 of query aligns to 1:207/252 of 7ac8A
Sites not aligning to the query:
1h5yB Hisf protein from pyrobaculum aerophilum (see paper)
42% identity, 81% coverage: 5:208/253 of query aligns to 6:210/253 of 1h5yB
Sites not aligning to the query:
3zr4E Structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex (see paper)
42% identity, 82% coverage: 1:208/253 of query aligns to 1:198/244 of 3zr4E
Sites not aligning to the query:
7qc8A Imidazole glycerol phosphate synthase subunit HisF (see paper)
42% identity, 82% coverage: 2:208/253 of query aligns to 2:207/250 of 7qc8A
5d2tA Directed evolutionary changes in kemp eliminase ke07 - crystal 3 wild type
39% identity, 91% coverage: 5:233/253 of query aligns to 3:229/251 of 5d2tA
6dnjA Directed evolutionary changes in kemp eliminase ke07 - crystal 28 round 5 (see paper)
38% identity, 92% coverage: 2:233/253 of query aligns to 1:230/250 of 6dnjA
2wjzE Crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity (see paper)
44% identity, 71% coverage: 29:208/253 of query aligns to 18:193/237 of 2wjzE
Sites not aligning to the query:
3iivB Evolutionary optimization of computationally designed enzymes: kemp eliminases of the ke07 series (see paper)
42% identity, 81% coverage: 2:206/253 of query aligns to 2:204/262 of 3iivB
Sites not aligning to the query:
4ewnD Structure of hisf-d130v+d176v with bound rcdrp (see paper)
40% identity, 82% coverage: 2:208/253 of query aligns to 1:200/243 of 4ewnD
Sites not aligning to the query:
P60664 Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 from Escherichia coli (strain K12) (see paper)
30% identity, 99% coverage: 1:251/253 of query aligns to 1:250/258 of P60664
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 70% coverage: 29:206/253 of query aligns to 276:503/552 of P33734
Sites not aligning to the query:
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
32% identity, 70% coverage: 29:206/253 of query aligns to 264:491/538 of 1ox4B
Sites not aligning to the query:
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
32% identity, 70% coverage: 29:206/253 of query aligns to 262:485/532 of 1ox5A
Sites not aligning to the query:
3tdmA Computationally designed tim-barrel protein, halfflr (see paper)
47% identity, 34% coverage: 123:208/253 of query aligns to 1:85/120 of 3tdmA
Sites not aligning to the query:
5dn1A Crystal structure of phosphoribosyl isomerase a from streptomyces coelicolor (see paper)
27% identity, 85% coverage: 1:214/253 of query aligns to 1:208/240 of 5dn1A
P16250 Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; EC 5.3.1.16; EC 5.3.1.24 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
27% identity, 85% coverage: 1:214/253 of query aligns to 1:208/240 of P16250
2y85A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound rcdrp (see paper)
31% identity, 62% coverage: 59:214/253 of query aligns to 50:202/234 of 2y85A
Sites not aligning to the query:
3zs4A Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
31% identity, 62% coverage: 59:214/253 of query aligns to 59:211/244 of 3zs4A
Sites not aligning to the query:
>HSERO_RS21020 FitnessBrowser__HerbieS:HSERO_RS21020
MLRTRVIPALLLQHESLVKTQRFSTFDYVGDPCNTVRIFNELEVDELFFLDIAASREKKG
PNLQLLADIANECFMPLGYGGGIRSLDDARSVFSIGFEKVAVNTHALENPSLISEIATEY
GSQAVVVSVDVKGGVLGGQTVRSHSGRHNTGRDPVAWAQEAERLGAGELFLTAIDREGTW
SGFDIDLVKKVTDAVSIPVIAHGGAGSLSDIRKVVKQAGASAVALGSMVVYQKQGNGILV
HFPETKELEATLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory