SitesBLAST
Comparing HSERO_RS21095 HSERO_RS21095 UDP-glucose 4-epimerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
64% identity, 99% coverage: 2:335/336 of query aligns to 11:344/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G11), T22 (= T13), G23 (= G14), S24 (= S15), F25 (= F16), S45 (= S36), R46 (= R37), D47 (= D38), K50 (= K41), D69 (= D60), V70 (= V61), A89 (= A80), A90 (= A81), A91 (= A82), K93 (= K84), L131 (= L122), T133 (= T124), K147 (= K138), Y173 (= Y164)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q85), V95 (= V86), K135 (= K126), N175 (= N166), S182 (= S173), V183 (= V174), L186 (= L177), T198 (= T189), T200 (= T191), M204 (= M195), V240 (= V231), R263 (= R254), E266 (= E257), Y278 (≠ M269), S313 (≠ F304), Y314 (≠ D305), E315 (≠ D306), Y316 (= Y307), N320 (= N311)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
64% identity, 99% coverage: 2:335/336 of query aligns to 11:344/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K84), Q94 (= Q85), N175 (= N166), S179 (= S170), R180 (= R171), S182 (= S173), V183 (= V174), L186 (= L177), T198 (= T189), I199 (= I190), T200 (= T191), M204 (= M195), R206 (= R197), V240 (= V231), R263 (= R254), E266 (= E257)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
65% identity, 99% coverage: 1:331/336 of query aligns to 1:312/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), G14 (= G14), S15 (= S15), F16 (= F16), S36 (= S36), R37 (= R37), D38 (= D38), K41 (= K41), D60 (= D60), V61 (= V61), A80 (= A80), A81 (= A81), A82 (= A82), K84 (= K84), T99 (= T99), L122 (= L122), K138 (= K138), Y164 (= Y164)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
61% identity, 99% coverage: 2:335/336 of query aligns to 3:316/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (= T13), G15 (= G14), F17 (= F16), S37 (= S36), R38 (= R37), D39 (= D38), K42 (= K41), D61 (= D60), V62 (= V61), R63 (= R62), A81 (= A80), A82 (= A81), A83 (= A82), K85 (= K84), S124 (= S123), T125 (= T124), K139 (= K138), Y165 (= Y164), G166 (= G165)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
53% identity, 99% coverage: 2:334/336 of query aligns to 1:270/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), T12 (= T13), G13 (= G14), S14 (= S15), F15 (= F16), S35 (= S36), R36 (= R37), D37 (= D38), K40 (= K41), D59 (= D60), V60 (= V61), A80 (= A81), A81 (= A82), K83 (= K84), L121 (= L122), T123 (= T124), K137 (= K138), Y163 (= Y164), G164 (= G165)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
40% identity, 94% coverage: 1:315/336 of query aligns to 1:317/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), G14 (= G14), S15 (= S15), F16 (= F16), S37 (= S36), R38 (= R37), D39 (= D38), K42 (= K41), D61 (= D60), V62 (= V61), A81 (= A80), A82 (= A81), A83 (= A82), K85 (= K84), T100 (= T99), L123 (= L122), S124 (= S123), K139 (= K138), Y165 (= Y164), G166 (= G165), V168 (= V167), S171 (= S170), R172 (= R171)
- binding uridine-5'-diphosphate: K127 (= K126), N167 (= N166), V175 (= V174), P191 (≠ T189), I192 (= I190), T193 (= T191), M197 (= M195), R199 (= R197), M233 (≠ V231), R252 (= R254)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
40% identity, 94% coverage: 1:315/336 of query aligns to 7:323/333 of O25511
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
40% identity, 94% coverage: 1:315/336 of query aligns to 3:319/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K84), S176 (= S173), V177 (= V174), T195 (= T191), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R254), E257 (= E257)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S36), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A83 (= A80), A84 (= A81), A85 (= A82), K87 (= K84), L125 (= L122), S126 (= S123), Y137 (≠ M134), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
40% identity, 94% coverage: 1:315/336 of query aligns to 3:319/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A83 (= A80), A84 (= A81), A85 (= A82), K87 (= K84), L125 (= L122), S126 (= S123), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167), R174 (= R171)
- binding uridine-5'-diphosphate-glucose: K87 (= K84), T127 (= T124), K129 (= K126), Y137 (≠ M134), N169 (= N166), S176 (= S173), V177 (= V174), P193 (≠ T189), T195 (= T191), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R254), E257 (= E257)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
40% identity, 94% coverage: 1:315/336 of query aligns to 3:319/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A84 (= A81), A85 (= A82), K87 (= K84), S126 (= S123), Y137 (≠ M134), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167), S173 (= S170), R174 (= R171)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K84), D128 (= D125), K129 (= K126), N169 (= N166), G175 (= G172), S176 (= S173), V177 (= V174), P193 (≠ T189), I194 (= I190), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R254), E257 (= E257)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
40% identity, 94% coverage: 1:315/336 of query aligns to 3:319/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S36), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A83 (= A80), A84 (= A81), A85 (= A82), K87 (= K84), T102 (= T99), L125 (= L122), S126 (= S123), T127 (= T124), Y137 (≠ M134), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167), S173 (= S170), R174 (= R171)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K84), T127 (= T124), D128 (= D125), K129 (= K126), Y137 (≠ M134), N169 (= N166), S176 (= S173), V177 (= V174), P193 (≠ T189), T195 (= T191), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R254), E257 (= E257)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
39% identity, 84% coverage: 2:283/336 of query aligns to 3:291/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (= T13), G15 (= G14), T16 (≠ S15), I17 (≠ F16), S37 (= S36), R38 (= R37), S39 (≠ D38), D63 (= D60), I64 (≠ V61), V83 (≠ A80), A84 (= A81), K87 (= K84), T125 (≠ L122), S127 (≠ T124), Y137 (≠ M134), K141 (= K138), F167 (≠ Y164), V170 (= V167), S173 (= S170), R174 (= R171)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K84), H88 (≠ Q85), S127 (≠ T124), N128 (≠ D125), Y137 (≠ M134), N169 (= N166), S176 (= S173), V177 (= V174), L180 (= L177), T192 (= T189), T194 (= T191), M198 (= M195), R200 (= R197), L234 (≠ V231), E265 (= E257)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
33% identity, 83% coverage: 2:281/336 of query aligns to 3:263/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ T13), G15 (= G14), S16 (= S15), L17 (≠ F16), R36 (= R37), D37 (= D38), D59 (= D60), I60 (≠ V61), A81 (= A80), A82 (= A81), A83 (= A82), K85 (= K84), V128 (≠ L122), Y140 (≠ M134), K144 (= K138), Y168 (= Y164), G169 (= G165), V171 (= V167)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
34% identity, 81% coverage: 2:273/336 of query aligns to 22:295/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S36), H57 (≠ R37), S82 (≠ D60), I83 (≠ V61), A104 (= A80), A105 (= A81), A106 (= A82), K108 (= K84), N123 (≠ T99), I146 (≠ L122), K162 (= K138), F184 (≠ Y164), G185 (= G165), N186 (= N166), V187 (= V167), S190 (= S170), S191 (≠ R171)
- binding uridine-5'-diphosphate: K150 (= K126), N186 (= N166), S193 (= S173), V194 (= V174), T209 (= T189), L210 (≠ I190), T211 (= T191), I215 (≠ M195), R217 (= R197), E279 (= E257)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
33% identity, 81% coverage: 2:273/336 of query aligns to 22:295/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S36), H57 (≠ R37), S82 (≠ D60), I83 (≠ V61), A104 (= A80), A105 (= A81), A106 (= A82), K108 (= K84), N123 (≠ T99), I146 (≠ L122), K162 (= K138), F184 (≠ Y164), G185 (= G165), N186 (= N166), V187 (= V167), S190 (= S170), S191 (≠ R171)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K84), H109 (≠ Q85), T148 (= T124), G185 (= G165), N186 (= N166), S193 (= S173), V194 (= V174), T209 (= T189), L210 (≠ I190), T211 (= T191), I215 (≠ M195), R217 (= R197), R276 (= R254), E279 (= E257)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
28% identity, 74% coverage: 5:251/336 of query aligns to 31:273/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G14), S41 (= S15), I42 (≠ F16), D62 (≠ S36), I63 (≠ R37), D92 (= D60), I93 (≠ V61), L114 (≠ A80), S115 (≠ A81), A116 (= A82), K118 (= K84), V158 (≠ L122), D161 (= D125), K174 (= K138), V198 (= V167), S201 (= S170)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
27% identity, 71% coverage: 5:242/336 of query aligns to 29:261/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G14), S39 (= S15), I40 (≠ F16), D60 (≠ S36), I61 (≠ R37), L89 (≠ G59), D90 (= D60), I91 (≠ V61), L112 (≠ A80), S113 (≠ A81), A114 (= A82), K116 (= K84), D159 (= D125), K172 (= K138), N195 (= N166), V196 (= V167), S199 (= S170)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
26% identity, 71% coverage: 7:245/336 of query aligns to 3:258/309 of 4zrnA
- active site: T117 (= T124), G119 (≠ K126), A120 (= A127), Y143 (≠ M134), K147 (= K138), Y181 (vs. gap), G185 (≠ S173)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (≠ S15), I12 (≠ F16), D31 (≠ F35), N32 (≠ S36), S34 (≠ D38), S35 (≠ E39), G36 (≠ K40), S51 (≠ D60), I52 (≠ V61), L73 (≠ A80), A74 (= A81), A75 (= A82), T92 (= T99), S115 (≠ L122), S116 (= S123), Y143 (≠ M134), K147 (= K138), Y170 (= Y164), V173 (= V167)
- binding uridine-5'-diphosphate-glucose: T117 (= T124), G119 (≠ K126), A120 (= A127), Y143 (≠ M134), N172 (= N166), G185 (≠ S173), V186 (= V174), H201 (≠ I188), F203 (≠ I190), Y208 (≠ M195), R210 (= R197), V244 (= V231)
Sites not aligning to the query:
6jkhA The NAD+-bound form of human nsdhl (see paper)
29% identity, 42% coverage: 9:148/336 of query aligns to 7:137/212 of 6jkhA
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), F13 (≠ S15), L14 (≠ F16), D33 (= D44), I34 (≠ L45), G48 (= G59), L50 (≠ V61), A70 (= A81), S71 (≠ A82), Y123 (≠ M134), K127 (= K138)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
24% identity, 76% coverage: 4:257/336 of query aligns to 3:272/310 of 6dntA
- active site: S120 (≠ D125), S121 (≠ K126), A122 (= A127), Y144 (≠ M134), K148 (= K138), A187 (≠ S173)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ K84), S120 (≠ D125), S121 (≠ K126), Y144 (≠ M134), F172 (≠ G165), N173 (= N166), A187 (≠ S173), V188 (= V174), K191 (≠ L177), V203 (≠ I188), I204 (≠ T189), Y205 (≠ I190), Q210 (≠ M195), R212 (= R197), I246 (≠ V231), R269 (= R254), D272 (≠ E257)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), G13 (= G14), F14 (≠ S15), I15 (≠ F16), D33 (≠ F35), N34 (≠ S36), L35 (≠ R37), S36 (≠ D38), S37 (≠ E39), G38 (≠ K40), D57 (= D60), L58 (≠ V61), L76 (≠ A80), A77 (= A81), A78 (= A82), A80 (≠ K84), S118 (= S123), S119 (≠ T124), Y144 (≠ M134), K148 (= K138), Y171 (= Y164), V174 (= V167)
- binding zinc ion: E209 (≠ N194)
Sites not aligning to the query:
Query Sequence
>HSERO_RS21095 HSERO_RS21095 UDP-glucose 4-epimerase
MFDDSVLMITGGTGSFGQTVLNRFLNTGVREIRVFSRDEKKQEDLRIALNNEKLRFYIGD
VRDPDSLRAAMKGVDYVFHAAALKQVPSCEFYPMEAVKTNVIGTENVLRVSSECGVRRVV
VLSTDKAVYPINAMGISKAMAEKVMVAAARTQRQGETVFCATRYGNVMASRGSVIPLFVS
QIKAEKPITITDPNMTRFLMSLEDSVDLVLYAFQHGQQGDIFVQKAPASTVADLASALKE
LFSSDTVVKTIGTRHGEKLYESLISREEMAHAQDMGDYYRIPADNRDLNYAKYFSEGDQD
ISLFDDYTSHNTRRLNVEQIKQLLLGLDFIKEELNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory